DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHGPx and gpx1a

DIOPT Version :9

Sequence 1:NP_728869.1 Gene:PHGPx / 38413 FlyBaseID:FBgn0035438 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_001007282.2 Gene:gpx1a / 352926 ZFINID:ZDB-GENE-030410-1 Length:191 Species:Danio rerio


Alignment Length:180 Identity:60/180 - (33%)
Similarity:94/180 - (52%) Gaps:25/180 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 YEFTVKDTHGNDVSLEKYKGKVVLVVNIASKCGLTKNNYEKLTDLKEKYGERGLVILNFPCNQFG 147
            |:.:.|...|:.::....||||||:.|:||. |.|..:|.::.:|..:|.::|||:|..||||||
Zfish     9 YDLSAKLLSGDLLNFSSLKGKVVLIENVASLUGTTVRDYTQMNELHSRYADQGLVVLGAPCNQFG 73

  Fly   148 SQMPEADGEAMVCHLRDSKADIG-----EVFAKVDVNGDNAAPLYKYLKAK-------QTGTLG- 199
            .| .....|.::..|:..:...|     ::..|::|||:||.||:.:||.|       ....:| 
Zfish    74 HQ-ENCKNEEILQSLKYVRPGNGFEPKFQILEKLEVNGENAHPLFAFLKEKLPQPSDDPVSLMGD 137

  Fly   200 -----------SGIKWNFTKFLVNKEGVPINRYAPTTDPMDIAKDIEKLL 238
                       :.|.|||.|||:..:|.|..||:.....:||..||::||
Zfish   138 PKFIIWSPVCRNDISWNFEKFLIGPDGEPFKRYSRRFLTIDIDADIKELL 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHGPxNP_728869.1 GSH_Peroxidase 81..234 CDD:238207 56/174 (32%)
gpx1aNP_001007282.2 GSH_Peroxidase 8..183 CDD:238207 56/174 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48732
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.