DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHGPx and Gpx7

DIOPT Version :9

Sequence 1:NP_728869.1 Gene:PHGPx / 38413 FlyBaseID:FBgn0035438 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_001100143.1 Gene:Gpx7 / 298376 RGDID:1306999 Length:186 Species:Rattus norvegicus


Alignment Length:189 Identity:68/189 - (35%)
Similarity:94/189 - (49%) Gaps:18/189 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 AISSAAQHSTAAAIDMSANGDYKNAASIYEFTVKDTHGNDVSLEKYKGKVVLVVNIASKCGLTKN 119
            |:::|.....|||...|..       ..|:|...:..|..||||||:|.|.||||:||:||.|..
  Rat     4 AVATAWLLLWAAACTQSEQ-------DFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQ 61

  Fly   120 NYEKLTDLKEKYGERGLVILNFPCNQFGSQMPEADGEAMVCHLRDSKADIGEVFAKVDVNGDNAA 184
            ||..|..|:...|.....:|.|||||||.|.|:::.|......|...... .:|:|:.|.|..|.
  Rat    62 NYRALQQLQRDLGPYHFNVLAFPCNQFGQQEPDSNREIENFARRTYSVSF-PMFSKIAVTGTGAH 125

  Fly   185 PLYKYLKAKQTGTLGSGIKWNFTKFLVNKEGVPINRYAPTTDPMD-----IAKDIEKLL 238
            |.:|||    |.|.|....|||.|:||..:|..:..:.||. |::     |.:.:.||:
  Rat   126 PAFKYL----TQTSGKEPTWNFWKYLVAPDGKVVGAWDPTV-PVEEIKPRITEQVMKLI 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHGPxNP_728869.1 GSH_Peroxidase 81..234 CDD:238207 60/157 (38%)
Gpx7NP_001100143.1 gpx7 23..175 CDD:131592 60/157 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 93 1.000 Domainoid score I7354
eggNOG 1 0.900 - - E1_COG0386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100297
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X276
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.680

Return to query results.
Submit another query.