DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHGPx and Gpx8

DIOPT Version :9

Sequence 1:NP_728869.1 Gene:PHGPx / 38413 FlyBaseID:FBgn0035438 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_001099881.1 Gene:Gpx8 / 294744 RGDID:1307506 Length:209 Species:Rattus norvegicus


Alignment Length:151 Identity:57/151 - (37%)
Similarity:84/151 - (55%) Gaps:10/151 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 SIYEFTVKDTHGNDVSLEKYKGKVVLVVNIASKCGLTKNNYEKLTDLKEKYGERGLVILNFPCNQ 145
            |.|.|.|||..|..|||||:|||..||||:||.|..|..:||.|.:|.:::|.....:|.|||||
  Rat    46 SFYSFEVKDAKGRMVSLEKFKGKASLVVNVASDCRFTDKSYETLRELHKEFGPYHFNVLAFPCNQ 110

  Fly   146 FGSQMPEADGEAMVCHLRDSKADIGEVFAKVDVNGDNAAPLYKYL--KAKQTGTLGSGIKWNFTK 208
            ||...|::..| :....|.:......:|.|:.:.|..|.|.:::|  .:|:..      :|||.|
  Rat   111 FGESEPKSSKE-VESFARKNYGVTFPIFHKIKILGPEAEPAFRFLVDSSKKEP------RWNFWK 168

  Fly   209 FLVNKEGVPINRYAPTTDPMD 229
            :|||.||..:..:.| .:|::
  Rat   169 YLVNPEGQVVKFWRP-EEPLE 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHGPxNP_728869.1 GSH_Peroxidase 81..234 CDD:238207 57/151 (38%)
Gpx8NP_001099881.1 gpx7 46..198 CDD:131592 57/151 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100297
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X276
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.680

Return to query results.
Submit another query.