DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHGPx and Gpx4

DIOPT Version :9

Sequence 1:NP_728869.1 Gene:PHGPx / 38413 FlyBaseID:FBgn0035438 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_001034938.1 Gene:Gpx4 / 29328 RGDID:69226 Length:253 Species:Rattus norvegicus


Alignment Length:224 Identity:87/224 - (38%)
Similarity:129/224 - (57%) Gaps:12/224 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SMRRTPGPVLELSRGQRQCLRLCTIMLPVSCAATPMNAISSAAQHSTA-AAIDMSAN-GDYKNAA 80
            |.|:.|||....:|.:|:.......|.|:.....|...:....|.|.: ..:.:.|: .|::.|.
  Rat    31 SPRKRPGPRRRRARARRRRRARPRRMEPIPEPFNPRPLLQDLPQTSNSHEFLGLCASRDDWRCAR 95

  Fly    81 SIYEFTVKDTHGNDVSLEKYKGKVVLVVNIASKCGLTKNNYEKLTDLKEKYGERGLVILNFPCNQ 145
            |::||..||..|:.|.|:||:|.|.:|.|:||: |.|..||.:|.||..:|.|.||.||.|||||
  Rat    96 SMHEFAAKDIDGHMVCLDKYRGCVCIVTNVASQUGKTDVNYTQLVDLHARYAECGLRILAFPCNQ 160

  Fly   146 FGSQMPEADGEAMVCHLRDSKADIG---EVFAKVDVNGDNAAPLYKYLKA--KQTGTLGSGIKWN 205
            ||.|.|.::.|     :::..|...   ::::|:.||||:|.||:|::|.  |..|.||:.||||
  Rat   161 FGRQEPGSNQE-----IKEFAAGYNVRFDMYSKICVNGDDAHPLWKWMKVQPKGRGMLGNAIKWN 220

  Fly   206 FTKFLVNKEGVPINRYAPTTDPMDIAKDI 234
            |||||::|.|..:.||.|..:|..|.||:
  Rat   221 FTKFLIDKNGCVVKRYGPMEEPQVIEKDL 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHGPxNP_728869.1 GSH_Peroxidase 81..234 CDD:238207 71/157 (45%)
Gpx4NP_001034938.1 GSH_Peroxidase 96..249 CDD:238207 71/157 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 93 1.000 Domainoid score I7354
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I4401
OMA 1 1.010 - - QHG48732
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 1 1.000 - - FOG0000791
OrthoInspector 1 1.000 - - otm45351
orthoMCL 1 0.900 - - OOG6_100297
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X276
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.880

Return to query results.
Submit another query.