DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHGPx and GPX7

DIOPT Version :9

Sequence 1:NP_728869.1 Gene:PHGPx / 38413 FlyBaseID:FBgn0035438 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_056511.2 Gene:GPX7 / 2882 HGNCID:4559 Length:187 Species:Homo sapiens


Alignment Length:156 Identity:58/156 - (37%)
Similarity:83/156 - (53%) Gaps:5/156 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 YEFTVKDTHGNDVSLEKYKGKVVLVVNIASKCGLTKNNYEKLTDLKEKYGERGLVILNFPCNQFG 147
            |:|...:..|..||||||:|.|.||||:||:||.|..:|..|..|:...|.....:|.|||||||
Human    26 YDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFG 90

  Fly   148 SQMPEADGEAMVCHLRDSKADIGEVFAKVDVNGDNAAPLYKYLKAKQTGTLGSGIKWNFTKFLVN 212
            .|.|:::.| :....|.:.:....:|:|:.|.|..|.|.:|||    ..|.|....|||.|:||.
Human    91 QQEPDSNKE-IESFARRTYSVSFPMFSKIAVTGTGAHPAFKYL----AQTSGKEPTWNFWKYLVA 150

  Fly   213 KEGVPINRYAPTTDPMDIAKDIEKLL 238
            .:|..:..:.||....::...|..|:
Human   151 PDGKVVGAWDPTVSVEEVRPQITALV 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHGPxNP_728869.1 GSH_Peroxidase 81..234 CDD:238207 56/150 (37%)
GPX7NP_056511.2 gpx7 24..176 CDD:131592 57/154 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I7330
eggNOG 1 0.900 - - E1_COG0386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100297
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16331
SonicParanoid 1 1.000 - - X276
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.710

Return to query results.
Submit another query.