DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHGPx and GPX5

DIOPT Version :9

Sequence 1:NP_728869.1 Gene:PHGPx / 38413 FlyBaseID:FBgn0035438 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_001500.1 Gene:GPX5 / 2880 HGNCID:4557 Length:221 Species:Homo sapiens


Alignment Length:186 Identity:63/186 - (33%)
Similarity:98/186 - (52%) Gaps:25/186 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 MSANGDYKNAASIYEFTVKDTHGND-VSLEKYKGKVVLVVNIASKCGLTKNNYEKLTDLKEKYGE 133
            |..:.|.|  .:||::.....:.|: ||.::|.||.:|.||:|:.||||. .|.:|..|:|:...
Human    30 MDCHKDEK--GTIYDYEAIALNKNEYVSFKQYVGKHILFVNVATYCGLTA-QYPELNALQEELKP 91

  Fly   134 RGLVILNFPCNQFGSQMPEADGEAMVCHLRDSKADIG-----EVFAKVDVNGDNAAPLYKYLK-- 191
            .|||:|.|||||||.|.| .|.:.::..|:..:...|     ::|.|.||||:....::.:||  
Human    92 YGLVVLGFPCNQFGKQEP-GDNKEILPGLKYVRPGGGFVPSFQLFEKGDVNGEKEQKVFSFLKHS 155

  Fly   192 ----AKQTGTLGS---------GIKWNFTKFLVNKEGVPINRYAPTTDPMDIAKDI 234
                ::..||..|         .|:|||.||||..:|:|:.|::.......:..||
Human   156 CPHPSEILGTFKSISWDPVKVHDIRWNFEKFLVGPDGIPVMRWSHRATVSSVKTDI 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHGPxNP_728869.1 GSH_Peroxidase 81..234 CDD:238207 58/173 (34%)
GPX5NP_001500.1 GSH_Peroxidase 39..211 CDD:238207 58/173 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.