DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHGPx and GPX3

DIOPT Version :9

Sequence 1:NP_728869.1 Gene:PHGPx / 38413 FlyBaseID:FBgn0035438 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_001316719.1 Gene:GPX3 / 2878 HGNCID:4555 Length:235 Species:Homo sapiens


Alignment Length:176 Identity:63/176 - (35%)
Similarity:91/176 - (51%) Gaps:21/176 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 AASIYEFTVKDTHGND-VSLEKYKGKVVLVVNIASKCGLTKNNYEKLTDLKEKYGERGLVILNFP 142
            :.:|||:......|.: :..::|.||.||.||:||..||| ..|.:|..|:|:....|||||.||
Human    46 SGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLT-GQYIELNALQEELAPFGLVILGFP 109

  Fly   143 CNQFGSQMPEADGEAM--VCHLRDSKADIG--EVFAKVDVNGDNAAPLYKYLKAKQTGT---LGS 200
            |||||.|.|..:.|.:  :.::|.....:.  ::|.|.||||:.....|.:||.....|   ||:
Human   110 CNQFGKQEPGENSEILPTLKYVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTSELLGT 174

  Fly   201 G------------IKWNFTKFLVNKEGVPINRYAPTTDPMDIAKDI 234
            .            |:|||.||||..:|:||.|:...|...::..||
Human   175 SDRLFWEPMKVHDIRWNFEKFLVGPDGIPIMRWHHRTTVSNVKMDI 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHGPxNP_728869.1 GSH_Peroxidase 81..234 CDD:238207 61/172 (35%)
GPX3NP_001316719.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.