DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHGPx and GPX2

DIOPT Version :9

Sequence 1:NP_728869.1 Gene:PHGPx / 38413 FlyBaseID:FBgn0035438 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_002074.2 Gene:GPX2 / 2877 HGNCID:4554 Length:190 Species:Homo sapiens


Alignment Length:184 Identity:58/184 - (31%)
Similarity:89/184 - (48%) Gaps:26/184 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 AASIYEFTVKDTHGNDVSLEKYKGKVVLVVNIASKCGLTKNNYEKLTDLKEKYGERGLVILNFPC 143
            |.|.|:.:.....|..|....::|:.||:.|:||..|.|..::.:|.:|:.::..| ||:|.|||
Human     5 AKSFYDLSAISLDGEKVDFNTFRGRAVLIENVASLUGTTTRDFTQLNELQCRFPRR-LVVLGFPC 68

  Fly   144 NQFGSQMPEADGEAMVCHLRDSKADIG-----EVFAKVDVNGDNAAPLYKYLKAK---------- 193
            ||||.| .....|.::..|:..:...|     .:..|.:|||.|..|::.|||.|          
Human    69 NQFGHQ-ENCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLKDKLPYPYDDPFS 132

  Fly   194 ---------QTGTLGSGIKWNFTKFLVNKEGVPINRYAPTTDPMDIAKDIEKLL 238
                     .:....|.:.|||.|||:..||.|..||:.|...::|..||::||
Human   133 LMTDPKLIIWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEPDIKRLL 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHGPxNP_728869.1 GSH_Peroxidase 81..234 CDD:238207 53/176 (30%)
GPX2NP_002074.2 GSH_Peroxidase 7..182 CDD:238207 53/176 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48732
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.