DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHGPx and gpx1

DIOPT Version :9

Sequence 1:NP_728869.1 Gene:PHGPx / 38413 FlyBaseID:FBgn0035438 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_596146.1 Gene:gpx1 / 2540222 PomBaseID:SPBC32F12.03c Length:158 Species:Schizosaccharomyces pombe


Alignment Length:162 Identity:77/162 - (47%)
Similarity:98/162 - (60%) Gaps:14/162 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 YEFTVKDTHGNDVSLEKYKGKVVLVVNIASKCGLTKNNYEKLTDLKEKYGERGLVILNFPCNQFG 147
            |:...||..||.......|||||||||.|||||.|. .|:.|..|.:||.:||.:||.|||||||
pombe     5 YDLAPKDKDGNPFPFSNLKGKVVLVVNTASKCGFTP-QYKGLEALYQKYKDRGFIILGFPCNQFG 68

  Fly   148 SQMPEADGE-AMVCHLRDSKADIGEVF---AKVDVNGDNAAPLYKYLKA--KQTGTLGSGIKWNF 206
            :|.|.:|.| |..|     :.:.|..|   ||::|||||..|:|::||:  ||.|.  ..|||||
pombe    69 NQEPGSDEEIAQFC-----QKNYGVTFPVLAKINVNGDNVDPVYQFLKSQKKQLGL--ERIKWNF 126

  Fly   207 TKFLVNKEGVPINRYAPTTDPMDIAKDIEKLL 238
            .|||||::|..|.||:..:.|..:..|||.:|
pombe   127 EKFLVNRQGQVIERYSSISKPEHLENDIESVL 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHGPxNP_728869.1 GSH_Peroxidase 81..234 CDD:238207 73/156 (47%)
gpx1NP_596146.1 BtuE 1..158 CDD:223463 76/160 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 98 1.000 Domainoid score I1869
eggNOG 1 0.900 - - E1_COG0386
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 133 1.000 Inparanoid score I1411
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000791
OrthoInspector 1 1.000 - - otm47225
orthoMCL 1 0.900 - - OOG6_100297
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16331
SonicParanoid 1 1.000 - - X276
TreeFam 00.000 Not matched by this tool.
109.790

Return to query results.
Submit another query.