DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHGPx and Gpx1

DIOPT Version :9

Sequence 1:NP_728869.1 Gene:PHGPx / 38413 FlyBaseID:FBgn0035438 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_110453.3 Gene:Gpx1 / 24404 RGDID:2729 Length:201 Species:Rattus norvegicus


Alignment Length:206 Identity:71/206 - (34%)
Similarity:104/206 - (50%) Gaps:38/206 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 SAAQHSTAAAIDMSANGDYKNAASIYEFTVKDTHGND-VSLEKYKGKVVLVVNIASKCGLTKNNY 121
            |||:.|..|            .:::|.|:.:...|.: |||...:|||:|:.|:||..|.|..:|
  Rat     2 SAARLSAVA------------QSTVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLUGTTTRDY 54

  Fly   122 EKLTDLKEKYGERGLVILNFPCNQFGSQMPEADGEAMVCHLRDSKADIG-----EVFAKVDVNGD 181
            .::.||:::.|.||||:|.|||||||.| .....|.::..|:..:...|     .:|.|.:|||:
  Rat    55 TEMNDLQKRLGPRGLVVLGFPCNQFGHQ-ENGKNEEILNSLKYVRPGGGFEPNFTLFEKCEVNGE 118

  Fly   182 NAAPLYKYLK-----------AKQTG--------TLGSGIKWNFTKFLVNKEGVPINRYAPTTDP 227
            .|.||:.:|:           |..|.        ...:.|.|||.||||..:|||:.||:.....
  Rat   119 KAHPLFTFLRNALPAPSDDPTALMTDPKYIIWSPVCRNDISWNFEKFLVGPDGVPVRRYSRRFRT 183

  Fly   228 MDIAKDIEKLL 238
            :||..|||.||
  Rat   184 IDIEPDIEALL 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHGPxNP_728869.1 GSH_Peroxidase 81..234 CDD:238207 61/177 (34%)
Gpx1NP_110453.3 GSH_Peroxidase 13..190 CDD:238207 61/177 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48732
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.