DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gtpx and gpx-4

DIOPT Version :10

Sequence 1:NP_728869.1 Gene:Gtpx / 38413 FlyBaseID:FBgn0035438 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_500242.2 Gene:gpx-4 / 190801 WormBaseID:WBGene00022377 Length:126 Species:Caenorhabditis elegans


Alignment Length:85 Identity:32/85 - (37%)
Similarity:52/85 - (61%) Gaps:3/85 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 SIYEFTVKDTHGNDVSLEKYKGKVVLVVNIASKCGLTKNNYEKLTDLKEKYGERGLVILNFPCNQ 145
            |:::|.::...|:...|.:|:|||.|:||:|:.|..|: .|.....:.:||.::||||..|||||
 Worm    39 SVFDFQIETLKGDYTDLSQYRGKVTLLVNVATFCAYTQ-QYTDFNPILDKYQKQGLVIAAFPCNQ 102

  Fly   146 FGSQMPEADGEAM--VCHLR 163
            |..|.|..:.|.:  :.|:|
 Worm   103 FYLQEPAENHELLNGLTHVR 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GtpxNP_728869.1 GSH_Peroxidase 81..234 CDD:238207 32/85 (38%)
gpx-4NP_500242.2 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 39..>116 CDD:469754 30/77 (39%)

Return to query results.
Submit another query.