DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHGPx and gpx-6

DIOPT Version :9

Sequence 1:NP_728869.1 Gene:PHGPx / 38413 FlyBaseID:FBgn0035438 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_001023368.1 Gene:gpx-6 / 188313 WormBaseID:WBGene00020373 Length:188 Species:Caenorhabditis elegans


Alignment Length:158 Identity:65/158 - (41%)
Similarity:104/158 - (65%) Gaps:1/158 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 SIYEFTVKDTHGNDVSLEKYKGKVVLVVNIASKCGLTKNNYEKLTDLKEKYGERGLVILNFPCNQ 145
            :||:|..|:..|..||:|||:.||||..|:||.||.|.:||....:|...|.|:|..:..|||||
 Worm    30 TIYQFQAKNIDGKMVSMEKYRDKVVLFTNVASYCGYTDSNYNAFKELDGIYREKGFRVAAFPCNQ 94

  Fly   146 FGSQMPEADGEAMVCHLRDSKADIGEVFAKVDVNGDNAAPLYKYLKAKQTGTLGSGIKWNFTKFL 210
            |..|.||.:|: ::..::.|.....::::|::|||.|..||:|:||.::..:|.:.|.|||:|||
 Worm    95 FEKQEPETEGK-ILDFVKSSYTYAPDMYSKIEVNGQNTHPLWKFLKKERGSSLSADIPWNFSKFL 158

  Fly   211 VNKEGVPINRYAPTTDPMDIAKDIEKLL 238
            |:|.|..:.||:.:.:|:|:.::|.:||
 Worm   159 VDKNGHVVGRYSHSVNPIDLEEEISRLL 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHGPxNP_728869.1 GSH_Peroxidase 81..234 CDD:238207 62/152 (41%)
gpx-6NP_001023368.1 GSH_Peroxidase 30..182 CDD:238207 62/152 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48732
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 1 1.000 - - FOG0000791
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100297
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16331
SonicParanoid 1 1.000 - - X276
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.