DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHGPx and gpx-2

DIOPT Version :9

Sequence 1:NP_728869.1 Gene:PHGPx / 38413 FlyBaseID:FBgn0035438 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_001368229.1 Gene:gpx-2 / 187630 WormBaseID:WBGene00011045 Length:179 Species:Caenorhabditis elegans


Alignment Length:187 Identity:88/187 - (47%)
Similarity:117/187 - (62%) Gaps:20/187 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 SAAQH----STAAAIDMSANGDYKNAASIYEFTVKDTHGNDVSLEKYKGKVVLVVNIASKCGLTK 118
            |||:.    |||:|:           ||::..|||:..|.|..|..|:|||:::||:||:||||.
 Worm     3 SAARRFISLSTASAM-----------ASVHGITVKNAQGEDTPLSNYQGKVLIIVNVASQCGLTN 56

  Fly   119 NNYEKLTDLKEKYGERGLVILNFPCNQFGSQMP--EADGEAMVCHLRDSKADIGEVFAKVDVNGD 181
            :||.:..:|.:.|.:.||.:|.|||||||.|.|  |.|..|.|.   |.......:|.|:|||||
 Worm    57 SNYNQFKELLDVYKKDGLEVLAFPCNQFGGQEPSCEIDIAAFVA---DKFKFEPTLFQKIDVNGD 118

  Fly   182 NAAPLYKYLKAKQTGTLGSGIKWNFTKFLVNKEGVPINRYAPTTDPMDIAKDIEKLL 238
            |.|||||:||.::.|.|...||||||||||.::|..|.|::|||:|.|:.||||..|
 Worm   119 NTAPLYKFLKQEKGGFLVDAIKWNFTKFLVGRDGHVIKRFSPTTEPKDMKKDIEAAL 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHGPxNP_728869.1 GSH_Peroxidase 81..234 CDD:238207 76/154 (49%)
gpx-2NP_001368229.1 GSH_Peroxidase 19..171 CDD:238207 76/154 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 110 1.000 Domainoid score I3951
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H133958
Inparanoid 1 1.050 161 1.000 Inparanoid score I2852
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48732
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 1 1.000 - - FOG0000791
OrthoInspector 1 1.000 - - mtm4796
orthoMCL 1 0.900 - - OOG6_100297
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16331
SonicParanoid 1 1.000 - - X276
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.910

Return to query results.
Submit another query.