DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHGPx and gpx-7

DIOPT Version :9

Sequence 1:NP_728869.1 Gene:PHGPx / 38413 FlyBaseID:FBgn0035438 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_001123171.1 Gene:gpx-7 / 187542 WormBaseID:WBGene00019846 Length:197 Species:Caenorhabditis elegans


Alignment Length:177 Identity:82/177 - (46%)
Similarity:110/177 - (62%) Gaps:16/177 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 IDMSANGDYKNAASIYEFTVKDTHGNDVSLEKYKGKVVLVVNIASKCGLTKNNYEKLTDLKEKYG 132
            ||||       ..:||:|:|:|..|:.|||:||.|.||::||:||.||||.:||::|..|.:||.
 Worm    26 IDMS-------TGTIYDFSVRDNSGDLVSLDKYSGLVVIIVNVASYCGLTNSNYKELKSLNDKYH 83

  Fly   133 ERGLVILNFPCNQFGSQMP--EADGEAMVCHLRDSKADIGEVFAKVDVNG----DNAAPLYKYLK 191
            .|||.:..|||||||.|.|  |||....|......:.|:   :.||.|||    ....||:.:||
 Worm    84 LRGLRVAAFPCNQFGFQEPHCEADINKFVNEKFSFEPDL---YGKVTVNGGPLIGEEEPLWTFLK 145

  Fly   192 AKQTGTLGSGIKWNFTKFLVNKEGVPINRYAPTTDPMDIAKDIEKLL 238
            .:|.|||...|||||||||||::|..:.|:.|:|:|....::|.|||
 Worm   146 KEQGGTLFDAIKWNFTKFLVNRQGKVVARFGPSTNPKSFEEEIVKLL 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHGPxNP_728869.1 GSH_Peroxidase 81..234 CDD:238207 74/158 (47%)
gpx-7NP_001123171.1 GSH_Peroxidase 32..188 CDD:238207 74/158 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 110 1.000 Domainoid score I3951
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I2852
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48732
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 1 1.000 - - FOG0000791
OrthoInspector 1 1.000 - - mtm4796
orthoMCL 1 0.900 - - OOG6_100297
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X276
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.880

Return to query results.
Submit another query.