DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHGPx and gpx2

DIOPT Version :9

Sequence 1:NP_728869.1 Gene:PHGPx / 38413 FlyBaseID:FBgn0035438 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_001243244.1 Gene:gpx2 / 100145152 XenbaseID:XB-GENE-989081 Length:190 Species:Xenopus tropicalis


Alignment Length:183 Identity:62/183 - (33%)
Similarity:89/183 - (48%) Gaps:24/183 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 AASIYEFTVKDTHGNDVSLEKYKGKVVLVVNIASKCGLTKNNYEKLTDLKEKYGERGLVILNFPC 143
            |.|.|:....:..|..|....::|:|||:.|:||. ..|..:|.:|.:|:.||..| ||:|.|||
 Frog     5 AKSFYDLYATNIDGEKVDFNVFRGRVVLIENVASLUDTTVRDYTQLNELQTKYPRR-LVVLGFPC 68

  Fly   144 NQFGSQMPEADGEAM--VCHLRDSKADIG--EVFAKVDVNGDNAAPLYKYLKAK------QTGTL 198
            ||||.|....:.|.:  :.::|..|..:.  .:|.|.||||.:...::.|||.|      :...|
 Frog    69 NQFGYQENCKNEEILNSLKYVRPGKGFVPGFTLFQKCDVNGKDTHSVFAYLKDKLPVPDNEPAAL 133

  Fly   199 -------------GSGIKWNFTKFLVNKEGVPINRYAPTTDPMDIAKDIEKLL 238
                         .|.|.|||.|||:..||.|..||......:.|..||::||
 Frog   134 ISDPRYIVWNPVHRSDISWNFEKFLIGPEGEPFKRYNKNFQTISIEPDIQRLL 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHGPxNP_728869.1 GSH_Peroxidase 81..234 CDD:238207 57/175 (33%)
gpx2NP_001243244.1 GSH_Peroxidase 7..182 CDD:238207 57/175 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483113at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.