DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12016 and NRK1

DIOPT Version :9

Sequence 1:NP_647805.1 Gene:CG12016 / 38411 FlyBaseID:FBgn0035436 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_014270.1 Gene:NRK1 / 855594 SGDID:S000005073 Length:240 Species:Saccharomyces cerevisiae


Alignment Length:276 Identity:62/276 - (22%)
Similarity:105/276 - (38%) Gaps:98/276 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LVIGISGVTCGGKTTLAHSLHDYFKGLRGAPLWNSPYTIGEVRLISQDDYF-----LPVEDKRHQ 64
            :::.:||.:..||||:             |.|..|.:|  :..||.:||::     :||:.|.:.
Yeast     7 ILVALSGCSSSGKTTI-------------AKLTASLFT--KATLIHEDDFYKHDNEVPVDAKYNI 56

  Fly    65 RN-EALNAINFELI-TSLDMAKMLNDIAHIIKGRHVAPEPQEHLVTYANFEHYAQQFQQQYQYNA 127
            :| ::..|::|:|. ..||:.|....||..:...:...:|      :..| |..:|...:.:  |
Yeast    57 QNWDSPEALDFKLFGKELDVIKQTGKIATKLIHNNNVDDP------FTKF-HIDRQVWDELK--A 112

  Fly   128 NYYKQANGGVYQYPPQQHPRHHPHHQQHHHQHHQIQQQQQHIMSINAQIAAQLRDKKVNFLLVEG 192
            .|                                        .|||        |.|...::|:|
Yeast   113 KY----------------------------------------DSIN--------DDKYEVVIVDG 129

  Fly   193 FMIFNQPELLALCNIKYHFHLPYEKCFERRSKRT---------YDPPDVTGYFELCVWPHYEKNF 248
            |||||...:....::|.....|||...:||:.|.         .|||   .||:..|:..|..|.
Yeast   130 FMIFNNTGISKKFDLKILVRAPYEVLKKRRASRKGYQTLDSFWVDPP---YYFDEFVYESYRANH 191

  Fly   249 SEYRDCKDITFLNGEI 264
            ::       .|:||::
Yeast   192 AQ-------LFVNGDV 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12016NP_647805.1 NRK1 6..255 CDD:238982 59/264 (22%)
NRK1NP_014270.1 NRK1 8..198 CDD:238982 60/271 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344451
Domainoid 1 1.000 61 1.000 Domainoid score I2551
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I1721
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002351
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103047
Panther 1 1.100 - - LDO PTHR10285
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R840
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.870

Return to query results.
Submit another query.