DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12016 and UKL3

DIOPT Version :9

Sequence 1:NP_647805.1 Gene:CG12016 / 38411 FlyBaseID:FBgn0035436 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001323275.1 Gene:UKL3 / 842031 AraportID:AT1G55810 Length:488 Species:Arabidopsis thaliana


Alignment Length:272 Identity:52/272 - (19%)
Similarity:88/272 - (32%) Gaps:99/272 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QWLVIGISGVTCGGKTT----LAHSLHDYFKGLRGAPLWNSP---YTIGEVRLISQDDYFLPVED 60
            |..|||::|....||||    :...|||     :.|.:.|..   :.:.||.|:...||      
plant    43 QPFVIGVAGGAASGKTTVCDMIMQQLHD-----QRAVVVNQDSFYHNVNEVELVRVHDY------ 96

  Fly    61 KRHQRNEALNAINFELITSLDMAKMLNDIAHIIKGRHVAPEPQEHLVTYANFEHYAQQFQQQYQY 125
                        ||:...:.|..::|:.:..:.||:         .|...|::.      :.|:.
plant    97 ------------NFDHPDAFDTEQLLSSMEKLRKGQ---------AVDIPNYDF------KSYKN 134

  Fly   126 NANYYKQANGGVYQYPPQQHPRHHPHHQQHHHQHHQIQQQQQHIMSINAQIAAQLRDKKVNFLLV 190
            |.            :||::                           :|..          :.:::
plant   135 NV------------FPPRR---------------------------VNPS----------DVIIL 150

  Fly   191 EGFMIFNQPELLALCNIKYHFHLPYEKCFERRSKRT-----YDPPDVTGYFELCVWPHYEKNFSE 250
            ||.:||:.|.:..|.|:|.......:....||.||.     .|...|...:...|.|.:|.....
plant   151 EGILIFHDPRVRDLMNMKIFVDADADVRLARRIKRDTVEKGRDIATVLDQYSKFVKPAFEDFILP 215

  Fly   251 YRDCKDITFLNG 262
            .:...||....|
plant   216 TKKYADIIIPRG 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12016NP_647805.1 NRK1 6..255 CDD:238982 48/260 (18%)
UKL3NP_001323275.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10285
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.