DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12016 and UK/UPRT1

DIOPT Version :9

Sequence 1:NP_647805.1 Gene:CG12016 / 38411 FlyBaseID:FBgn0035436 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_198903.1 Gene:UK/UPRT1 / 834088 AraportID:AT5G40870 Length:486 Species:Arabidopsis thaliana


Alignment Length:227 Identity:42/227 - (18%)
Similarity:74/227 - (32%) Gaps:88/227 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QWLVIGISGVTCGGKTT----LAHSLHDYFKGLRGAPLWNSPYTIGEVRLISQDDYFLPVEDKRH 63
            |..:||:||.|..||||    :...|||:                 .|.|::||.::..:..:..
plant    61 QPFIIGVSGGTASGKTTVCDMIIQQLHDH-----------------RVVLVNQDSFYRGLTSEEL 108

  Fly    64 QRNEALNAINFELITSLDMAKMLNDIAHIIKGRHVAPEPQEHLVTYANFEHYAQQFQQQYQYNAN 128
            ||   :...||:...:.|..::|                           |.|:..:        
plant   109 QR---VQEYNFDHPDAFDTEQLL---------------------------HCAETLK-------- 135

  Fly   129 YYKQANGGVYQYPPQQHPRHHPHHQQHHHQHHQIQQQQQHIMSINAQIAAQLRDKKVNFLLVEGF 193
                 :|..||.|......|              |::......:||.          :.:::||.
plant   136 -----SGQPYQVPIYDFKTH--------------QRRSDTFRQVNAS----------DVIILEGI 171

  Fly   194 MIFNQPELLALCNIKYHFHLPYEKCFERRSKR 225
            ::|:...:..|.|:|.......:....||.:|
plant   172 LVFHDSRVRNLMNMKIFVDTDADVRLARRIRR 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12016NP_647805.1 NRK1 6..255 CDD:238982 41/224 (18%)
UK/UPRT1NP_198903.1 UMPK 64..262 CDD:238981 41/224 (18%)
UPRTase 280..481 CDD:405383
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10285
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.