DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12016 and UKL4

DIOPT Version :9

Sequence 1:NP_647805.1 Gene:CG12016 / 38411 FlyBaseID:FBgn0035436 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001320072.1 Gene:UKL4 / 828757 AraportID:AT4G26510 Length:469 Species:Arabidopsis thaliana


Alignment Length:227 Identity:38/227 - (16%)
Similarity:73/227 - (32%) Gaps:90/227 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QWLVIGISGVTCGGKTT----LAHSLHDYFKGLRGAPLWNSPYTIGEVRLISQDDYFLPVEDKRH 63
            |..|||::|....||||    :...|||.                 .|.||:.|.::..:.::..
plant    48 QPFVIGVAGGAASGKTTVCDMIIQQLHDQ-----------------RVVLINLDSFYHNLTEEEL 95

  Fly    64 QRNEALNAINFELITSLDMAKMLNDIAHIIKGRHVAPEPQEHLVTYANFEHYAQQFQQQYQYNAN 128
            .|   ::..||:...:.|...:|:.:..:.:|:.| ..|:....|                |.::
plant    96 AR---VHEYNFDHPDAFDTEHLLSCMEKLRQGQAV-DIPKYDFKT----------------YRSS 140

  Fly   129 YYKQANGGVYQYPPQQHPRHHPHHQQHHHQHHQIQQQQQHIMSINAQIAAQLRDKKVNFLLVEGF 193
            .:::.|                                                 ..:.:::||.
plant   141 VFRRVN-------------------------------------------------PTDVIILEGI 156

  Fly   194 MIFNQPELLALCNIKYHFHLPYEKCFERRSKR 225
            ::|:.|.:..|.|:|.......:....||.||
plant   157 LLFHDPRVRKLMNMKIFVCTDADVRLARRIKR 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12016NP_647805.1 NRK1 6..255 CDD:238982 37/224 (17%)
UKL4NP_001320072.1 UMPK 51..244 CDD:238981 37/224 (17%)
UPRTase 265..466 CDD:405383
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10285
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.