DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12016 and UKL5

DIOPT Version :9

Sequence 1:NP_647805.1 Gene:CG12016 / 38411 FlyBaseID:FBgn0035436 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_189380.1 Gene:UKL5 / 822365 AraportID:AT3G27440 Length:465 Species:Arabidopsis thaliana


Alignment Length:233 Identity:41/233 - (17%)
Similarity:73/233 - (31%) Gaps:97/233 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPQWLVIGISGVTCGGKTTLAH----SLHDYFKGLRGAPLWNSPYTIGEVRLISQDDYFLPVEDK 61
            :.|..|||::|.|..||||:.:    .|||.                 .|.|::||.::      
plant    26 LKQPFVIGVAGGTASGKTTVCNMIMSQLHDQ-----------------RVVLVNQDSFY------ 67

  Fly    62 RHQ-RNEALNAI---NFELITSLDMAKMLNDIAHIIKGRHVAPEPQEHLVTYANFEHYAQQFQQQ 122
             |. ..|.||.:   ||:...:.:...:|:.:..:..|:.|            |...|..:..|.
plant    68 -HSLTKEKLNKVHEYNFDHPDAFNTEVLLSCMEKLRSGQPV------------NIPSYDFKIHQS 119

  Fly   123 YQYNANYYKQANGGVYQYPPQQHPRHHPHHQQHHHQHHQIQQQQQHIMSINAQIAAQLRDKKVNF 187
            .:.::    ..|.|                                                 :.
plant   120 IESSS----PVNPG-------------------------------------------------DV 131

  Fly   188 LLVEGFMIFNQPELLALCNIKYHFHLPYEKCFERRSKR 225
            :::||.::.|.|.:..|.|:|.......:....||.:|
plant   132 IILEGILVLNDPRVRDLMNMKIFVDTDADVRLSRRIQR 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12016NP_647805.1 NRK1 6..255 CDD:238982 40/228 (18%)
UKL5NP_189380.1 UMPK 31..228 CDD:238981 40/228 (18%)
UPRTase 246..447 CDD:405383
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10285
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.