DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12016 and Jup

DIOPT Version :10

Sequence 1:NP_647805.1 Gene:CG12016 / 38411 FlyBaseID:FBgn0035436 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_112309.2 Gene:Jup / 81679 RGDID:620412 Length:745 Species:Rattus norvegicus


Alignment Length:63 Identity:16/63 - (25%)
Similarity:28/63 - (44%) Gaps:18/63 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 TTLAHSLHDYFKGLRGAPLWNSPYTIGEVRLISQDDYFLPVEDKRHQRNEALNAINFELITSL 80
            |::.|:|..:.:||  ..::.|......||::|.     |||           ::.|..||:|
  Rat   206 TSILHNLSHHREGL--LAIFKSGGIPALVRMLSS-----PVE-----------SVLFYAITTL 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12016NP_647805.1 NRK1 6..255 CDD:238982 16/63 (25%)
JupNP_112309.2 CTNNAbd_CTNNB1-like 73..142 CDD:459249
Adaptin_N <120..>289 CDD:396262 16/63 (25%)
Interaction with DSC1 and DSG1. /evidence=ECO:0000250 132..297 16/63 (25%)
armadillo repeat 144..169 CDD:293788
armadillo repeat 186..212 CDD:293788 2/5 (40%)
armadillo repeat 221..253 CDD:293788 11/46 (24%)
Arm 221..253 CDD:425727 11/46 (24%)
armadillo repeat 261..297 CDD:293788
ARM 5 298..341
armadillo repeat 305..338 CDD:293788
PLN03200 <328..>658 CDD:215629
ARM 341..381 CDD:214547
ARM 6 342..381
armadillo repeat 345..380 CDD:293788
ARM 7 383..420
armadillo repeat 393..418 CDD:293788
ARM 8 423..464
armadillo repeat 426..464 CDD:293788
ARM 9 470..510
armadillo repeat 470..508 CDD:293788
ARM 10 512..551
armadillo repeat 515..572 CDD:293788
Interaction with DSC1. /evidence=ECO:0000250 574..661
armadillo repeat 577..611 CDD:293788
armadillo repeat 618..652 CDD:293788
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.