DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12016 and Jup

DIOPT Version :9

Sequence 1:NP_647805.1 Gene:CG12016 / 38411 FlyBaseID:FBgn0035436 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_112309.2 Gene:Jup / 81679 RGDID:620412 Length:745 Species:Rattus norvegicus


Alignment Length:63 Identity:16/63 - (25%)
Similarity:28/63 - (44%) Gaps:18/63 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 TTLAHSLHDYFKGLRGAPLWNSPYTIGEVRLISQDDYFLPVEDKRHQRNEALNAINFELITSL 80
            |::.|:|..:.:||  ..::.|......||::|.     |||           ::.|..||:|
  Rat   206 TSILHNLSHHREGL--LAIFKSGGIPALVRMLSS-----PVE-----------SVLFYAITTL 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12016NP_647805.1 NRK1 6..255 CDD:238982 16/63 (25%)
JupNP_112309.2 Interaction with DSC1 and DSG1. /evidence=ECO:0000250 132..297 16/63 (25%)
armadillo repeat 144..169 CDD:293788
armadillo repeat 186..212 CDD:293788 2/5 (40%)
armadillo repeat 221..253 CDD:293788 11/46 (24%)
Arm 221..253 CDD:395413 11/46 (24%)
armadillo repeat 261..297 CDD:293788
ARM 5 298..341
armadillo repeat 305..338 CDD:293788
PLN03200 <328..>658 CDD:215629
ARM 341..381 CDD:214547
ARM 6 342..381
armadillo repeat 345..380 CDD:293788
ARM 7 383..420
armadillo repeat 393..418 CDD:293788
ARM 8 423..464
armadillo repeat 426..464 CDD:293788
ARM 9 470..510
armadillo repeat 470..508 CDD:293788
ARM 10 512..551
armadillo repeat 515..572 CDD:293788
Interaction with DSC1. /evidence=ECO:0000250 574..661
armadillo repeat 577..611 CDD:293788
armadillo repeat 618..652 CDD:293788
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.