DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12016 and UCK2

DIOPT Version :10

Sequence 1:NP_647805.1 Gene:CG12016 / 38411 FlyBaseID:FBgn0035436 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_036606.2 Gene:UCK2 / 7371 HGNCID:12562 Length:261 Species:Homo sapiens


Alignment Length:203 Identity:38/203 - (18%)
Similarity:71/203 - (34%) Gaps:63/203 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PMTVSTRLIDAGSTIMQRRLPVKQMNTHVSTFAIYGGDMSRLIGTHHYVHRVNDEFL-QCAVYAS 78
            |:.:.:.......||  :.:...:...|..|..    |:..:|.|       .:|.: :|.....
Human    19 PLVIYSSCSKVKKTI--KDMSENKQEVHPDTIT----DVEAVIDT-------EEELIKECEEMWK 70

  Fly    79 DRSDA----PLIGIEYVISDRLYETLSEDEQKL----WHSHAYEVKSGSWAYPRLPEVVAAPELK 135
            |..|.    .|||.         |||:..:.:|    ........:.|.|. .|.||::  |..:
Human    71 DMEDCQNKLSLIGT---------ETLTNADAQLSLLIMQMKCLTAELGQWK-KRKPEII--PLNE 123

  Fly   136 NIAKTYGKFWCTWQIDRGDKLPMGAPELMMSPQGVGQGVLRPELVKRRDEKYNISTDDLKHTRAE 200
            ::..|.||       :...||.... |:::|            .::.::||..   :||:.    
Human   124 DVLLTLGK-------EEFQKLRCDL-EMVLS------------TIQSKNEKLK---EDLER---- 161

  Fly   201 IAEPEWIN 208
              |.:|::
Human   162 --EQQWLD 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12016NP_647805.1 NRK1 6..255 CDD:238982 38/203 (19%)
UCK2NP_036606.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24 1/4 (25%)
UMPK 22..228 CDD:238981 37/200 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 236..261
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.