DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12016 and UCK2

DIOPT Version :9

Sequence 1:NP_647805.1 Gene:CG12016 / 38411 FlyBaseID:FBgn0035436 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_036606.2 Gene:UCK2 / 7371 HGNCID:12562 Length:261 Species:Homo sapiens


Alignment Length:137 Identity:32/137 - (23%)
Similarity:59/137 - (43%) Gaps:26/137 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VIGISGVTCGGKTTLAHSLHDYFKGLRGAPLWNSPYTIGEVRLISQDDYFLPVEDKRHQRNEALN 70
            :||:||.|..||:::...:..    |.|..  ...|...:|.::|||.::..:..:  |:.:||.
Human    22 LIGVSGGTASGKSSVCAKIVQ----LLGQN--EVDYRQKQVVILSQDSFYRVLTSE--QKAKALK 78

  Fly    71 A-INFELITSLDMAKMLNDIAHIIKGR--------HVAPEPQEHLVT-----YANFE----HYAQ 117
            . .||:...:.|...:|..:..|.:|:        .|:...:|..||     ...||    .|:|
Human    79 GQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQ 143

  Fly   118 QFQQQYQ 124
            :.:..:|
Human   144 EVRDLFQ 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12016NP_647805.1 NRK1 6..255 CDD:238982 32/137 (23%)
UCK2NP_036606.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24 0/1 (0%)
UMPK 22..228 CDD:238981 32/137 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 236..261
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.