DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12016 and mibp

DIOPT Version :9

Sequence 1:NP_647805.1 Gene:CG12016 / 38411 FlyBaseID:FBgn0035436 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_571768.2 Gene:mibp / 64674 ZFINID:ZDB-GENE-030404-1 Length:201 Species:Danio rerio


Alignment Length:268 Identity:69/268 - (25%)
Similarity:107/268 - (39%) Gaps:90/268 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VIGISGVTCGGKTTLAHSLHDYFKGLRGAPLWNSPYTIGEVRLISQDDYFLPVEDKRHQRNEALN 70
            :|||.|||.||||||.:.|      ::..|         ...::.|||:|.|.:    |....::
Zfish     4 IIGIGGVTNGGKTTLTNRL------IKALP---------NCCVVHQDDFFKPPD----QIAVGMD 49

  Fly    71 AI-NFELITSLDMAKMLNDIAHIIKGRHVAPEPQEHLVTYANFEHYAQQFQQQYQYNANYYKQAN 134
            .. .:::|.:|||..|:|    .|||                                       
Zfish    50 GFKQWDVIDALDMEAMVN----TIKG--------------------------------------- 71

  Fly   135 GGVYQYPPQQHPRHHPHHQQHHHQHHQIQQQQQHIMSINAQIAAQLRD--KKVNFLLVEGFMIFN 197
               :...|.:..|.|                     .|....|.::.|  .:|:.|:||||:::|
Zfish    72 ---WLENPVKFARSH---------------------GIQVTPATEMEDPESQVHILIVEGFLLYN 112

  Fly   198 QPELLALCNIKYHFHLPYEKCFERRSKRTYDPPDVTGYFELCVWPHYEKNFSEYRDC-KDITFLN 261
            ...||.:.:..|:..:|||:|.:|||.|.|..||..|.|:..|||.|.|:.....:| ..|.:|:
Zfish   113 YKPLLDVFDKSYYITIPYEECKKRRSTRQYTVPDPPGLFDGHVWPMYLKHRFAMENCGLPIEYLD 177

  Fly   262 GEIAKEKI 269
            |...|::|
Zfish   178 GLKTKDEI 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12016NP_647805.1 NRK1 6..255 CDD:238982 64/252 (25%)
mibpNP_571768.2 NRK1 4..170 CDD:238982 63/251 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593561
Domainoid 1 1.000 89 1.000 Domainoid score I7816
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 116 1.000 Inparanoid score I4795
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002351
OrthoInspector 1 1.000 - - otm24481
orthoMCL 1 0.900 - - OOG6_103047
Panther 1 1.100 - - O PTHR10285
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2461
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.890

Return to query results.
Submit another query.