DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12016 and uckl1a

DIOPT Version :9

Sequence 1:NP_647805.1 Gene:CG12016 / 38411 FlyBaseID:FBgn0035436 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_005167107.1 Gene:uckl1a / 570547 ZFINID:ZDB-GENE-040724-238 Length:547 Species:Danio rerio


Alignment Length:306 Identity:56/306 - (18%)
Similarity:95/306 - (31%) Gaps:97/306 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PQW-----------LVIGISGVTCGGKTTLAHSLHDYFKGLRGAPLWNSPYTIGEVRLISQDDYF 55
            |.|           .|||:.|.:..||||:|:.:.:..         :.|:.:    |:|.|.::
Zfish    79 PPWYNEHGAQFKEAFVIGLCGGSASGKTTVANKIIEAL---------DVPWVV----LLSMDSFY 130

  Fly    56 LPVEDKRHQRNEALNAINFELITSLDMAKMLNDIAHIIKGRHVAPEPQEHLVTYANFEHYAQQFQ 120
             .|.....|...|.|..||:...:.|...::..:..:.:|:.|.       :...:|..:.:|.:
Zfish   131 -KVLSAEEQALAASNDYNFDHPGAFDFELLVTTLRKLKQGKSVK-------IPVYDFTTHGRQKE 187

  Fly   121 QQYQYNANYYKQANGGVYQYPPQQHPRHHPHHQQHHHQHHQIQQQQQHIMSINAQIAAQLRDKKV 185
            .:..|.|                                                          
Zfish   188 WKNVYGA---------------------------------------------------------- 194

  Fly   186 NFLLVEGFMIFNQPELLALCNIKYHFHLPYEKCFERRSKR--TYDPPDVTG---YFELCVWPHYE 245
            :.::.||.:.|...|||.|.::|.......:....||.:|  |....|:.|   .:...|.|.:|
Zfish   195 SVIIFEGILSFADKELLQLMDMKIFVDTDSDIRLVRRLRRDITERGRDIEGVIKQYNKFVKPAFE 259

  Fly   246 KNFSEYRDCKDITFLNGEIAKEKILAFVLHRIVHYFKERCEVPAPA 291
            :.........||....|......|...|.|  ||...|..|:...|
Zfish   260 QYIEPTMRLSDIVVPRGGGNMVAIDLIVQH--VHSQLEEREISVRA 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12016NP_647805.1 NRK1 6..255 CDD:238982 43/253 (17%)
uckl1aXP_005167107.1 Udk 93..300 CDD:223645 53/287 (18%)
UMPK 94..293 CDD:238981 51/279 (18%)
UPRTase 323..526 CDD:291353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.