DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12016 and prune2

DIOPT Version :9

Sequence 1:NP_647805.1 Gene:CG12016 / 38411 FlyBaseID:FBgn0035436 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001104624.2 Gene:prune2 / 556822 ZFINID:ZDB-GENE-050309-222 Length:321 Species:Danio rerio


Alignment Length:128 Identity:20/128 - (15%)
Similarity:43/128 - (33%) Gaps:34/128 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 QEHLVTYANFEHYAQQFQQQYQYNANYYKQANGGVYQYPPQQHPRHHPHHQQHHHQHHQIQQQQ- 166
            |||.:...:.|.|     |:...:..||......:..:.....|      ......:|:|.:.. 
Zfish   125 QEHRINMKSIEPY-----QKVISHGGYYSNGANAIIVFAACFLP------DSDREDYHEIMENLF 178

  Fly   167 QHIMSINAQIAAQLRDKKVNFLLVEGFMIFNQPELLALCNIKYHFHLP----YEKCFERRSKR 225
            .:::|            .:..::.|.:||      :.|.....|..:|    .::|::...:|
Zfish   179 LYVIS------------TLELMVAEDYMI------VYLNGATPHRRMPGLNWLKRCYQMIDRR 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12016NP_647805.1 NRK1 6..255 CDD:238982 20/128 (16%)
prune2NP_001104624.2 BNIP2 35..150 CDD:372150 8/29 (28%)
CRAL_TRIO_2 152..283 CDD:372686 12/96 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.