DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12016 and NMRK1

DIOPT Version :9

Sequence 1:NP_647805.1 Gene:CG12016 / 38411 FlyBaseID:FBgn0035436 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001317607.1 Gene:NMRK1 / 54981 HGNCID:26057 Length:203 Species:Homo sapiens


Alignment Length:279 Identity:65/279 - (23%)
Similarity:111/279 - (39%) Gaps:94/279 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ISGVTCGGKTTLAHSLHDYFKGLRGAPLWNSPYTIGEVRLISQDDYFLPVEDKRHQRNEALNAIN 73
            ||.||..||||||.:|..:               :....:|||||:|.|..:....:|   ..:.
Human    12 ISCVTNSGKTTLAKNLQKH---------------LPNCSVISQDDFFKPESEIETDKN---GFLQ 58

  Fly    74 FELITSLDMAKMLNDIAHIIKGRHVAPEPQEHLVTYANFEHYAQQFQQQYQYNANYYKQANGGVY 138
            ::::.:|:|.||::.|:..:                                             
Human    59 YDVLEALNMEKMMSAISCWM--------------------------------------------- 78

  Fly   139 QYPPQQHPRHHPHHQQHHHQHHQIQQQQQHIMSINAQIAAQLRDKKVNFLLVEGFMIFNQPELLA 203
                 :..||                   .::|.:.:.|     :::..|::|||::||...|..
Human    79 -----ESARH-------------------SVVSTDQESA-----EEIPILIIEGFLLFNYKPLDT 114

  Fly   204 LCNIKYHFHLPYEKCFERRSKRTYDPPDVTGYFELCVWPHYEKNFSEYRDCK-DITFLNGEIAKE 267
            :.|..|...:|||:|..|||.|.|.|||..|||:..|||.|.|...|.:|.. ::.:|:|..::|
Human   115 IWNRSYFLTIPYEECKRRRSTRVYQPPDSPGYFDGHVWPMYLKYRQEMQDITWEVVYLDGTKSEE 179

  Fly   268 KILAFVLHRIVHYF-KERC 285
            .:...|...::... |::|
Human   180 DLFLQVYEDLIQELAKQKC 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12016NP_647805.1 NRK1 6..255 CDD:238982 59/245 (24%)
NMRK1NP_001317607.1 NRK1 12..164 CDD:238982 58/243 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157777
Domainoid 1 1.000 95 1.000 Domainoid score I7423
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6787
Inparanoid 1 1.050 119 1.000 Inparanoid score I4783
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002351
OrthoInspector 1 1.000 - - otm41655
orthoMCL 1 0.900 - - OOG6_103047
Panther 1 1.100 - - O PTHR10285
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R840
SonicParanoid 1 1.000 - - X2461
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.780

Return to query results.
Submit another query.