DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12016 and UCKL1

DIOPT Version :9

Sequence 1:NP_647805.1 Gene:CG12016 / 38411 FlyBaseID:FBgn0035436 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_024307683.1 Gene:UCKL1 / 54963 HGNCID:15938 Length:612 Species:Homo sapiens


Alignment Length:331 Identity:62/331 - (18%)
Similarity:103/331 - (31%) Gaps:109/331 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PQW-----------LVIGISGVTCGGKTTLAHSLHDYFKGLRGAPLWNSPYTIGEVRLISQDDYF 55
            |.|           ..||:.|.:..||||:|..:.:..         :.|:.:    |:|.|.::
Human    85 PPWYNEHGTQSKEAFAIGLGGGSASGKTTVARMIIEAL---------DVPWVV----LLSMDSFY 136

  Fly    56 -----LP--VEDKRHQRNEALNAINFELITSLDMAKMLNDIAHIIKGRHVAPEPQEHLVTYANFE 113
                 ||  |..::.|...|.|..||:...:.|...:::.:..:.:|:.|.       |...:|.
Human   137 KLLHSLPHQVLTEQQQEQAAHNNFNFDHPDAFDFDLIISTLKKLKQGKSVK-------VPIYDFT 194

  Fly   114 HYAQQFQQQYQYNANYYKQANGGVYQYPPQQHPRHHPHHQQHHHQHHQIQQQQQHIMSINAQIAA 178
            .::::...:..|.|                                                   
Human   195 THSRKKDWKTLYGA--------------------------------------------------- 208

  Fly   179 QLRDKKVNFLLVEGFMIFNQPELLALCNIKYHFHLPYEKCFERR-----SKRTYDPPDVTGYFEL 238
                   |.::.||.|.|....||.|.::|.......:....||     |:|..|...|...:..
Human   209 -------NVIIFEGIMAFADKTLLELLDMKIFVDTDSDIRLVRRLRRDISERGRDIEGVIKQYNK 266

  Fly   239 CVWPHYEKNFSEYRDCKDITFLNGEIAKEKILAFVLHRIVH-YFKERC-----EVPAPAPVVCPP 297
            .|.|.:::.........||....|......|...|.|  || ..:|.|     .||..||....|
Human   267 FVKPSFDQYIQPTMRLADIVVPRGSGNTVAIDLIVQH--VHSQLEEGCAGLGTPVPPAAPDAERP 329

  Fly   298 QQKRFG 303
            ::...|
Human   330 EEHAAG 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12016NP_647805.1 NRK1 6..255 CDD:238982 44/260 (17%)
UCKL1XP_024307683.1 UMPK 101..307 CDD:238981 52/285 (18%)
UPRTase <417..596 CDD:317125
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.