DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12016 and MBIP

DIOPT Version :9

Sequence 1:NP_647805.1 Gene:CG12016 / 38411 FlyBaseID:FBgn0035436 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_057670.2 Gene:MBIP / 51562 HGNCID:20427 Length:344 Species:Homo sapiens


Alignment Length:172 Identity:24/172 - (13%)
Similarity:52/172 - (30%) Gaps:72/172 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 NSPYTIGEVRLISQDDYFLPVEDKRHQRNEALNAINFELITSLDMAKMLNDIAHIIKGR-HVAPE 101
            |..::||:::           |:::|:.                     :|:..:.|.: |..||
Human   116 NDKFSIGDLQ-----------EEEKHKE---------------------SDLRDVKKTQIHFDPE 148

  Fly   102 PQEHLVTYANFEHYAQQF--QQQYQYNANYYKQ-------------------------------A 133
            ..:.....|..:.....|  ::|.:.|.|..::                               .
Human   149 VVQIKAGKAEIDRRISAFIERKQAEINENNVREFCNVIDCNQENSCARTDAIFTPYPGFKSHVKV 213

  Fly   134 NGGVYQYPPQQHPR------HHPHHQQHHHQHHQIQQQQQHI 169
            :..|..|.||..|.      |.|:.......:..::::.|:|
Human   214 SRVVNTYGPQTRPEGIPGSGHKPNSMLRDCGNQAVEERLQNI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12016NP_647805.1 NRK1 6..255 CDD:238982 24/172 (14%)
MBIPNP_057670.2 Interaction with MAP3K12 172..344 11/84 (13%)
Leucine-zipper 1. /evidence=ECO:0000255 271..285
Leucine-zipper 2. /evidence=ECO:0000255 314..329
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157779
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.