DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12016 and Nmrk1

DIOPT Version :9

Sequence 1:NP_647805.1 Gene:CG12016 / 38411 FlyBaseID:FBgn0035436 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_008758512.1 Gene:Nmrk1 / 499330 RGDID:1564687 Length:213 Species:Rattus norvegicus


Alignment Length:300 Identity:73/300 - (24%)
Similarity:111/300 - (37%) Gaps:113/300 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VIGISGVTCGGKTTLAHSLHDYFKGLRGAPLWNSPYTIGEVRLISQDDYFLPVEDKRHQRNEALN 70
            ||||.|||.|||||||.:|..               .:....:|||||:|.|..:.....|   .
  Rat     5 VIGIGGVTNGGKTTLAKNLQK---------------RLPNCSVISQDDFFKPESEIDIDEN---G 51

  Fly    71 AINFELITSLDMAKMLNDIAHIIK--GRHVAPEPQEHLVTYANFEHYAQQFQQQYQYNANYYKQA 133
            .:.::::.:|:|.||::.::..::  |....|...|                           .|
  Rat    52 FLQYDVLEALNMEKMMSAVSCWMENPGSSAGPAALE---------------------------SA 89

  Fly   134 NGGVYQYPPQQHPRHHPHHQQHHHQHHQIQQQQQHIMSINAQIAAQLRDKKVNFLLVEGFMIFNQ 198
            .|                                                 |..|::|||::||.
  Rat    90 QG-------------------------------------------------VPILIIEGFLLFNY 105

  Fly   199 PELLALCNIKYHFHLPYEKCFERRSKRTYDPPDVTGYFELCVWPHYEKNFSEYRDCK-DITFLNG 262
            ..|..:.|..|...:|||:|..|||.|.|:|||..|||:..|||.|.|:..|..... ||.:|:|
  Rat   106 KPLDTIWNRSYFLTVPYEECKRRRSTRVYEPPDPPGYFDGHVWPMYLKHRQEMNSITWDIVYLDG 170

  Fly   263 EIAKEKILAFVLHRI--------------VH--YFKERCE 286
            ..::|.:.:.|...:              ||  |.::.|:
  Rat   171 TRSEEDLFSQVYEDVKQELEKQNAVRLLEVHHVYSQDLCQ 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12016NP_647805.1 NRK1 6..255 CDD:238982 63/250 (25%)
Nmrk1XP_008758512.1 NRK1 5..158 CDD:238982 62/246 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351744
Domainoid 1 1.000 98 1.000 Domainoid score I7008
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6787
Inparanoid 1 1.050 115 1.000 Inparanoid score I4734
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002351
OrthoInspector 1 1.000 - - otm45777
orthoMCL 1 0.900 - - OOG6_103047
Panther 1 1.100 - - O PTHR10285
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2461
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.750

Return to query results.
Submit another query.