DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12016 and uck1

DIOPT Version :9

Sequence 1:NP_647805.1 Gene:CG12016 / 38411 FlyBaseID:FBgn0035436 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001004666.1 Gene:uck1 / 447928 ZFINID:ZDB-GENE-040912-113 Length:277 Species:Danio rerio


Alignment Length:115 Identity:26/115 - (22%)
Similarity:50/115 - (43%) Gaps:28/115 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VIGISGVTCGGKTTLAHSLHDYFKGLRGAPLWNSPYTIGE---------VRLISQDDYFLPVEDK 61
            :||:||.|..||:|:...:.:               .:|:         |.::|||.::..:..:
Zfish    19 LIGVSGGTASGKSTVCAKIME---------------LLGQNKVDHHQRKVTIVSQDSFYRVLTPE 68

  Fly    62 RHQRNEALNA-INFELITSLDMAKMLNDIAHIIKGRHVAPEPQEHLVTYA 110
              |:.:||.. .||:...:.|...|...:..|::|: |...|....||::
Zfish    69 --QKAKALKGQYNFDHPDAFDTEFMCQTLKDIVEGK-VVEVPTYDFVTHS 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12016NP_647805.1 NRK1 6..255 CDD:238982 26/115 (23%)
uck1NP_001004666.1 Udk 15..226 CDD:223645 26/115 (23%)
UMPK 19..224 CDD:238981 26/115 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 241..277
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.