DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12016 and nmrk2

DIOPT Version :9

Sequence 1:NP_647805.1 Gene:CG12016 / 38411 FlyBaseID:FBgn0035436 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001314713.1 Gene:nmrk2 / 447879 ZFINID:ZDB-GENE-040912-44 Length:198 Species:Danio rerio


Alignment Length:265 Identity:69/265 - (26%)
Similarity:111/265 - (41%) Gaps:87/265 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VIGISGVTCGGKTTLAHSLHDYFKGLRGAPLWNSPYTIGEVRLISQDDYFLPVEDKRHQRNEALN 70
            :|||.|||.||||||.           |..:.|.|    ...::.|||:|.| :|:.....:...
Zfish     4 IIGIGGVTNGGKTTLT-----------GRLIKNLP----NCCVVHQDDFFKP-QDQIELGEDGFR 52

  Fly    71 AINFELITSLDMAKMLNDIAHIIKGRHVAPEPQEHLVTYANFEHYAQQFQQQYQYNANYYKQANG 135
              .:::||:|||..|:|    .:||.      .|:.|.:|                         
Zfish    53 --QWDVITALDMDAMVN----TVKGW------MENPVKFA------------------------- 80

  Fly   136 GVYQYPPQQHPRHHPHHQQHHHQHHQIQQQQQHIMSINAQIAAQLRDKKVNFLLVEGFMIFNQPE 200
                                          :.|.:|::   .....|..::.|:||||:::|...
Zfish    81 ------------------------------RSHGVSVS---TTSDPDSDIHILIVEGFLLYNYKP 112

  Fly   201 LLALCNIKYHFHLPYEKCFERRSKRTYDPPDVTGYFELCVWPHYEKNFSEYRDCK-DITFLNGEI 264
            |:.:.|..::..:|||:|..|||.|||..||..|.|:..|||.|.|:.:|..:.. ||.:|:|..
Zfish   113 LIDVYNKCFYVTIPYEECKRRRSTRTYTVPDPPGLFDGHVWPMYLKHRTEMENSSLDIQYLDGMS 177

  Fly   265 AKEKI 269
            :|:::
Zfish   178 SKDEL 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12016NP_647805.1 NRK1 6..255 CDD:238982 64/248 (26%)
nmrk2NP_001314713.1 NRK1 4..167 CDD:238982 64/248 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593560
Domainoid 1 1.000 89 1.000 Domainoid score I7816
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 116 1.000 Inparanoid score I4795
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002351
OrthoInspector 1 1.000 - - otm24481
orthoMCL 1 0.900 - - OOG6_103047
Panther 1 1.100 - - O PTHR10285
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R840
SonicParanoid 1 1.000 - - X2461
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.780

Return to query results.
Submit another query.