DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12016 and MOCS2

DIOPT Version :9

Sequence 1:NP_647805.1 Gene:CG12016 / 38411 FlyBaseID:FBgn0035436 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_004522.1 Gene:MOCS2 / 4338 HGNCID:7193 Length:188 Species:Homo sapiens


Alignment Length:97 Identity:19/97 - (19%)
Similarity:33/97 - (34%) Gaps:26/97 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 CFERRSKRTYDPPDVTGYFELCVWPHYEKNFSEYRD-CKDITFLNGEIAKEKILAFVLHRIVHYF 281
            ||...:|....||.|    |...:....|:..|..: .||                    ::::.
Human    10 CFSLETKLPLSPPLV----EDSAFEPSRKDMDEVEEKSKD--------------------VINFT 50

  Fly   282 KERCEVPAPAPVVCPPQQKRFGMLYMGPSNNN 313
            .|:..|...:.:|..|...... |::|.:.||
Human    51 AEKLSVDEVSQLVISPLCGAIS-LFVGTTRNN 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12016NP_647805.1 NRK1 6..255 CDD:238982 9/37 (24%)
MOCS2NP_004522.1 MoaE 54..177 CDD:238385 7/29 (24%)
Substrate binding. /evidence=ECO:0000255|HAMAP-Rule:MF_03052 143..144
Substrate binding. /evidence=ECO:0000255|HAMAP-Rule:MF_03052 166..168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R840
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.