DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12016 and Mocs2B

DIOPT Version :9

Sequence 1:NP_647805.1 Gene:CG12016 / 38411 FlyBaseID:FBgn0035436 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_651340.1 Gene:Mocs2B / 43017 FlyBaseID:FBgn0039280 Length:367 Species:Drosophila melanogaster


Alignment Length:100 Identity:20/100 - (20%)
Similarity:34/100 - (34%) Gaps:36/100 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 CGGKTTLAHSLHDYFKGLRGAPLWNSPY---TIGEVRLISQD--DYFLPVEDKRH---------- 63
            ||..:....:..|.|:|.:...|....|   .:.|:..|..|  ..:|   |.:|          
  Fly    25 CGASSVFVGTTRDNFQGKKVLSLAYEAYDSMALKEMNKICSDLRSKWL---DLKHIVIYHRLGTV 86

  Fly    64 --------------QRNEALNAINFELITSLDMAK 84
                          .|:|||.:::|    ::|..|
  Fly    87 PVCEASVVIAASSPHRSEALESVSF----AIDQLK 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12016NP_647805.1 NRK1 6..255 CDD:238982 19/99 (19%)
Mocs2BNP_651340.1 MoaE 11..137 CDD:238385 19/99 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467064
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R840
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.