DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12016 and Uck

DIOPT Version :9

Sequence 1:NP_647805.1 Gene:CG12016 / 38411 FlyBaseID:FBgn0035436 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001138105.1 Gene:Uck / 42894 FlyBaseID:FBgn0263398 Length:305 Species:Drosophila melanogaster


Alignment Length:289 Identity:51/289 - (17%)
Similarity:98/289 - (33%) Gaps:89/289 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VIGISGVTCGGKTTLAHSLHDYFKGLRGAPLWNSPYTIGEVRLISQDDYF---LPVEDKRHQRNE 67
            :||::|.|..||:|:...:   .:.|..|.:   .:|..:|..||||.::   .|.|..:.|:  
  Fly    29 LIGVAGGTASGKSTVCKKI---MEQLGQAEM---DHTQRQVVSISQDSFYRELTPAEKAKAQK-- 85

  Fly    68 ALNAINFELITSLDMAKMLNDIAHIIKGRHVAPEPQEHLVTYANFEHYAQQFQQQYQYNANYYKQ 132
              ...||:...:.:...|.:.:.:|:||..|.....::.....:||:.                 
  Fly    86 --GLFNFDHPDAFNEELMYSTLQNILKGHKVEIPSYDYRTNSLDFENV----------------- 131

  Fly   133 ANGGVYQYPPQQHPRHHPHHQQHHHQHHQIQQQQQHIMSINAQIAAQLRDKKVNFLLVEGFMIFN 197
                :..||                                           .:.:|.||.::|.
  Fly   132 ----LVIYP-------------------------------------------ADVVLFEGILVFY 149

  Fly   198 QPELLALCNIKYHFHLPYEKCFERR-----SKRTYDPPDVTGYFELCVWPHYEKNFSEYRDCKDI 257
            .|::..|.::|.......:....||     ::|..|...|...:...|.|.:|:..|..:...|:
  Fly   150 FPKIRELFHMKLFVDTDSDTRLARRVPRDINERGRDLDAVLTQYMTFVKPAFEEFCSPTKKFADV 214

  Fly   258 TFLNG-------EIAKEKILAFVLHRIVH 279
            ....|       ::..:.|..|:.:|..|
  Fly   215 IIPRGADNTVAIDLIVQHIRDFLNNRSRH 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12016NP_647805.1 NRK1 6..255 CDD:238982 45/256 (18%)
UckNP_001138105.1 UMPK 29..235 CDD:238981 48/279 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10285
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.