DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12016 and Mbip

DIOPT Version :9

Sequence 1:NP_647805.1 Gene:CG12016 / 38411 FlyBaseID:FBgn0035436 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_038968430.1 Gene:Mbip / 362740 RGDID:1306310 Length:349 Species:Rattus norvegicus


Alignment Length:109 Identity:19/109 - (17%)
Similarity:33/109 - (30%) Gaps:32/109 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 VYQYPPQQHPR------HHPHHQQHHHQHHQIQQQQQHIMS---------INAQIAAQLRDKKVN 186
            |..|.||..|.      |.|........:..::::.|:|.:         :...|..:::..:..
  Rat   222 VNTYGPQTRPEGIAGSGHKPTGMLRDCGNQAVEERLQNIEAHLRLQTGGPVPRDIYQRIKKLEDK 286

  Fly   187 FLLVEGFMIFNQPELLALCNIKYHFHLPYEKCFERRSKRTYDPP 230
            .|.:||.    .||.....|..             ..:|...||
  Rat   287 ILELEGI----SPEYFQSVNFS-------------GKRRKVQPP 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12016NP_647805.1 NRK1 6..255 CDD:238982 19/109 (17%)
MbipXP_038968430.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351746
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.