DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12016 and ctnnb2

DIOPT Version :9

Sequence 1:NP_647805.1 Gene:CG12016 / 38411 FlyBaseID:FBgn0035436 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001001889.1 Gene:ctnnb2 / 324004 ZFINID:ZDB-GENE-040426-2575 Length:778 Species:Danio rerio


Alignment Length:188 Identity:40/188 - (21%)
Similarity:66/188 - (35%) Gaps:61/188 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ISGVTCGGKTTLAHSLHD--YFKGLRGAPLW----NSP------YTIGEVRLISQD--------- 52
            :.|.| |....||..:|:  ..:||...||:    .||      ...|.:..::||         
Zfish   569 VEGCT-GALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEA 632

  Fly    53 -DYFLPVEDKRHQRNEAL--------------------NAINFELITSLDMAKML--NDIAHIIK 94
             ....|:.:..|.|||.:                    ..::.||.:||...:.:  |:.|.:  
Zfish   633 EGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADL-- 695

  Fly    95 GRHVAPEPQEHLVTYANFEHYAQQFQQQYQYNANYYKQANG--GVYQYPPQQHPRHHP 150
            |..:. .|.|.|...|:...|.       .:::.|..:|.|  |:.    :|...|||
Zfish   696 GLDIG-APGETLAYRADEPSYR-------SFHSGYAAEALGMEGLL----EQEMSHHP 741

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12016NP_647805.1 NRK1 6..255 CDD:238982 40/188 (21%)
ctnnb2NP_001001889.1 ARM <151..221 CDD:237987
armadillo repeat 152..177 CDD:293788
armadillo repeat 187..220 CDD:293788
ARM 228..347 CDD:237987
armadillo repeat 229..261 CDD:293788
armadillo repeat 269..305 CDD:293788
armadillo repeat 311..346 CDD:293788
ARM 349..389 CDD:214547
armadillo repeat 353..388 CDD:293788
ARM 398..517 CDD:237987
armadillo repeat 401..426 CDD:293788
armadillo repeat 434..472 CDD:293788
armadillo repeat 481..516 CDD:293788
ARM 483..622 CDD:237987 13/53 (25%)
armadillo repeat 523..581 CDD:293788 4/12 (33%)
armadillo repeat 586..620 CDD:293788 7/33 (21%)
ARM 588..>667 CDD:237987 14/78 (18%)
armadillo repeat 628..661 CDD:293788 5/32 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.