DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12016 and arm

DIOPT Version :10

Sequence 1:NP_647805.1 Gene:CG12016 / 38411 FlyBaseID:FBgn0035436 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_476665.2 Gene:arm / 31151 FlyBaseID:FBgn0000117 Length:843 Species:Drosophila melanogaster


Alignment Length:130 Identity:29/130 - (22%)
Similarity:44/130 - (33%) Gaps:48/130 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LISQDDYFLPVEDKRHQRNEAL--------------------NAINFELITSLDMAKMLNDIAHI 92
            :|.|:....|:.|..|.|||.:                    ..::.||..|| :.:..|..|:.
  Fly   643 IIEQEGATGPLTDLLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSIELTNSL-LREDNNIWANA 706

  Fly    93 IKGRHVAPEPQEHLVTYANFEHYAQQFQQQYQYNANYYKQANGGVY-QYPPQQHPRH--HPHHQQ 154
            ..|  :.|:.|:.|..                      ::|..|:| |.||..|..|  ...|||
  Fly   707 DLG--MGPDLQDMLGP----------------------EEAYEGLYGQGPPSVHSSHGGRAFHQQ 747

  Fly   155  154
              Fly   748  747

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12016NP_647805.1 NRK1 6..255 CDD:238982 29/130 (22%)
armNP_476665.2 CTNNAbd_dArm 85..159 CDD:439243
Adaptin_N <150..>314 CDD:396262
armadillo repeat 161..186 CDD:293788
armadillo repeat 193..231 CDD:293788
armadillo repeat 238..270 CDD:293788
armadillo repeat 278..314 CDD:293788
armadillo repeat 320..355 CDD:293788
Arm 361..398 CDD:425727
armadillo repeat 362..397 CDD:293788
armadillo repeat 410..435 CDD:293788
Arm 439..481 CDD:425727
armadillo repeat 443..481 CDD:293788
armadillo repeat 490..525 CDD:293788
Arm 597..636 CDD:425727
armadillo repeat 600..636 CDD:293788
armadillo repeat 641..675 CDD:293788 8/31 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.