DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12016 and Uck2

DIOPT Version :9

Sequence 1:NP_647805.1 Gene:CG12016 / 38411 FlyBaseID:FBgn0035436 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_038946718.1 Gene:Uck2 / 304944 RGDID:620742 Length:267 Species:Rattus norvegicus


Alignment Length:255 Identity:46/255 - (18%)
Similarity:84/255 - (32%) Gaps:90/255 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 VRLISQD--DYFLPVEDKRHQRNEALNAIN--FELITSLDMAKMLNDIAHIIKGRHVAPEPQEHL 106
            |:|:.|:  ||        ||:...:.:.:  :.::||...||.|       ||:.         
  Rat    47 VQLLGQNEVDY--------HQKQVVILSQDSFYRVLTSEQKAKAL-------KGQF--------- 87

  Fly   107 VTYANFEHYAQQFQQQYQYNANYYKQ-ANGGVYQYPPQQHPRHHPHHQQHHHQHHQIQQQQQHIM 170
                ||:| ...|..:..:..  .|: ..|...|.|......|              .::::.:.
  Rat    88 ----NFDH-PDAFDNELIFKT--LKEITEGKTVQIPVYDFVSH--------------SRKEETVT 131

  Fly   171 SINAQIAAQLRDKKVNFLLVEGFMIFNQPELLALCNIKYHFHLPYEKCFERR-----SKRTYDPP 230
            ...|.:           :|.||.:.|...|:..|..:|.......:....||     |:|..|..
  Rat   132 IYPADV-----------VLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLE 185

  Fly   231 DVTGYFELCVWPHYE------KNFSE----------------YRDCKDITFLNGEIAKEK 268
            .:...:...|.|.:|      |.:::                .:..:||  |||.::|.:
  Rat   186 QILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDI--LNGGLSKRQ 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12016NP_647805.1 NRK1 6..255 CDD:238982 40/240 (17%)
Uck2XP_038946718.1 UMPK 38..234 CDD:238981 40/242 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.