DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12016 and NMRK2

DIOPT Version :9

Sequence 1:NP_647805.1 Gene:CG12016 / 38411 FlyBaseID:FBgn0035436 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001276046.1 Gene:NMRK2 / 27231 HGNCID:17871 Length:235 Species:Homo sapiens


Alignment Length:293 Identity:75/293 - (25%)
Similarity:118/293 - (40%) Gaps:93/293 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LVIGISGVTCGGKTTLAHSLHDYFKGLRGAPLWNSPYTIGEVRLISQDDYF-LPVEDKRHQRNEA 68
            |::||.|:|.||||||.:||      ||..|         ...:|.|||:| .|:...:.|  .|
Human     3 LIVGIGGMTNGGKTTLTNSL------LRALP---------NCCVIHQDDFFKAPLFQPQDQ--IA 50

  Fly    69 LNAINF---ELITSLDMAKMLNDIAHIIKGRHVAPEPQEHLVTYANFEHYAQQFQQQYQYNANYY 130
            :....|   :::.||||..||:.:                                         
Human    51 VGEDGFKQWDVLESLDMEAMLDTV----------------------------------------- 74

  Fly   131 KQANGGVYQYPPQQHPRHHPHHQQHHHQHHQIQQQQQHIMSINAQIAAQLRDKKVNFLLVEGFMI 195
             ||    :...||:..|.|                         .::.|......:.||:|||::
Human    75 -QA----WLSSPQKFARAH-------------------------GVSVQPEASDTHILLLEGFLL 109

  Fly   196 FNQPELLALCNIKYHFHLPYEKCFERRSKRTYDPPDVTGYFELCVWPHYEKNFSEYR-DCKDITF 259
            ::...|:.|.:.:|...:|||:|..|||.|.|..||..|.|:..|||.|:|...|.. :..::.:
Human   110 YSYKPLVDLYSRRYFLTVPYEECKWRRSTRNYTVPDPPGLFDGHVWPMYQKYRQEMEANGVEVVY 174

  Fly   260 LNGEIAKEKILAFVLHRIVHYFKERCEVPAPAP 292
            |:|..::|::...||..|.:....|.:..||:|
Human   175 LDGMKSREELFREVLEDIQNSLLNRSQESAPSP 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12016NP_647805.1 NRK1 6..255 CDD:238982 64/253 (25%)
NMRK2NP_001276046.1 NRK1 4..169 CDD:238982 64/252 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157778
Domainoid 1 1.000 95 1.000 Domainoid score I7423
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4783
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002351
OrthoInspector 1 1.000 - - otm41655
orthoMCL 1 0.900 - - OOG6_103047
Panther 1 1.100 - - O PTHR10285
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R840
SonicParanoid 1 1.000 - - X2461
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.780

Return to query results.
Submit another query.