DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12016 and SPBP22H7.06

DIOPT Version :9

Sequence 1:NP_647805.1 Gene:CG12016 / 38411 FlyBaseID:FBgn0035436 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_595603.1 Gene:SPBP22H7.06 / 2541315 PomBaseID:SPBP22H7.06 Length:230 Species:Schizosaccharomyces pombe


Alignment Length:275 Identity:61/275 - (22%)
Similarity:105/275 - (38%) Gaps:100/275 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LVIGISGVTCGGKTTLAHSLHDYFKGLRGAPLWNSPYTIGEVRLISQDDYF-----LPVEDKRHQ 64
            :::|:||.:|.||:||...||..|:|               ..|:.:||::     :||:     
pombe     6 IIVGVSGASCSGKSTLCQLLHAIFEG---------------SSLVHEDDFYKTDAEIPVK----- 50

  Fly    65 RNEALNAI-NFELITSLDMAKMLNDIAHIIKGRHVAPEPQEHLVTYANFEHYAQQFQQQYQYNAN 128
                 |.| :::...||::...|.:: |.|:...|.|   .||....| ::.|.:...:|   |:
pombe    51 -----NGIADWDCQESLNLDAFLENL-HYIRDHGVLP---THLRNREN-KNVAPEALIEY---AD 102

  Fly   129 YYKQANGGVYQYPPQQHPRHHPHHQQHHHQHHQIQQQQQHIMSINAQIAAQLRDKKVNFLLVEGF 193
            ..|:     ::.|                   .|...:||:                  :.|:||
pombe   103 IIKE-----FKAP-------------------AIPTLEQHL------------------VFVDGF 125

  Fly   194 MIFNQPELLALCNIKYHFHLPYEKCFERRSKRT---------YDPPDVTGYFELCVWPHYEKNFS 249
            |::...:|:...:|:......::....||..||         .|||.   |||..|||.|....|
pombe   126 MMYVNEDLINAFDIRLMLVTDFDTLKRRREARTGYITLEGFWQDPPH---YFENYVWPGYVHGHS 187

  Fly   250 EYRDCKDITFLNGEI 264
            .       .|:||::
pombe   188 H-------LFVNGDV 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12016NP_647805.1 NRK1 6..255 CDD:238982 58/263 (22%)
SPBP22H7.06NP_595603.1 Udk 1..230 CDD:223645 61/275 (22%)
NRK1 7..193 CDD:238982 59/270 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002351
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103047
Panther 1 1.100 - - LDO PTHR10285
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R840
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.890

Return to query results.
Submit another query.