Protein Alignment CG12016 and Mbip

DIOPT Version :9

• Sequence 1: NP_647805.1
• Gene: CG12016 / 38411
• FlyBaseID: FBgn0035436
• Length: 323
• Species: Drosophila melanogaster
• Sequence 2: NP_663417.1
• Gene: Mbip / 217588
• MGIID: 1918320
• Length: 341
• Species: Mus musculus
• Alignment Length: 109
• Identity: 19/109 - (17%)
• Similarity: 33/109 - (30%)
• Gaps: 32/109 - (29%)

  Fly   137 VYQYPPQQHPR------HHPHHQQHHHQHHQIQQQQQHIMS---------INAQIAAQLRDKKVN 186
            |..|.||..|.      |.|........:..::::.|:|.:         :...|..:::..:..
Mouse   215 VNTYGPQTRPEGIAGSGHKPTGMLRDCGNQAVEERLQNIEAHLRLQTGGPVPRDIYQRIKKLEDK 279

  Fly   187 FLLVEGFMIFNQPELLALCNIKYHFHLPYEKCFERRSKRTYDPP 230
            .|.:||.    .||.....|..             ..:|...||
Mouse   280 ILELEGI----SPEYFQSVNFS-------------GKRRKVQPP 306

Known Domains

Gene	Sequence	Domain	Region	External ID	Identity
CG12016	NP_647805.1	NRK1	6..255	CDD:238982	19/109 (17%)
Mbip	NP_663417.1	Interaction with MAP3K12	170..341		19/109 (17%)
		Leucine-zipper 1. /evidence=ECO:0000255	269..283		2/13 (15%)
		Leucine-zipper 2. /evidence=ECO:0000255	312..327

Information from Original Tools

Tool	Simple Score	Weighted Score	Original Tool Information
			BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C167848166
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.930