DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12016 and nmrk-1

DIOPT Version :9

Sequence 1:NP_647805.1 Gene:CG12016 / 38411 FlyBaseID:FBgn0035436 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_491763.1 Gene:nmrk-1 / 188966 WormBaseID:WBGene00020842 Length:340 Species:Caenorhabditis elegans


Alignment Length:268 Identity:57/268 - (21%)
Similarity:92/268 - (34%) Gaps:102/268 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VIGISGVTCGGKTTLAHSLHDYFKGLRGAPLWNSPYTIGEVRLISQDDYFLPVEDKRHQRNEALN 70
            |:.::|.|..||:|||.....:|    ||         ||..:|:||:::               
 Worm     8 VLALAGCTNSGKSTLAKEFQRFF----GA---------GETTIINQDEFY--------------- 44

  Fly    71 AINFELITSLDMAKMLNDIAHIIKGRHVAPEPQEHLVTYANFEHYAQQFQQQYQYNANYYKQANG 135
                         |..|::..|..     |: .|||..    |.|...|.::...|         
 Worm    45 -------------KTENEVEKIYH-----PD-AEHLTD----EGYYWSFDEKEAIN--------- 77

  Fly   136 GVYQYPPQQHPRHHPHHQQHHHQHHQIQQQQQHIMSINAQIAAQLRDKKVNFLLVEGFMIFNQPE 200
                                      |.|.:|.|::         ..|....::::|.||....|
 Worm    78 --------------------------IDQFRQRILN---------ESKVYKNVIIDGNMITEMDE 107

  Fly   201 LLALCNIKYHFHLPYEKCFERRSKRT-YDPPDVTGYFELCVWP----HYEKNFSEYRDCKDITFL 260
            ::.||:......|.::.|..||..|| |.|.|..|||....:|    |.|:.....|....:||:
 Worm   108 IVDLCDRIVVMTLDFKTCKRRREARTDYVPADTPGYFVNVAFPAYVRHLERARQRSRTDSRLTFI 172

  Fly   261 NGEIAKEK 268
              ::::.|
 Worm   173 --DVSESK 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12016NP_647805.1 NRK1 6..255 CDD:238982 54/253 (21%)
nmrk-1NP_491763.1 NRK1 8..163 CDD:238982 53/249 (21%)
MoaE 205..332 CDD:238385
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 67 1.000 Domainoid score I6493
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R840
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.800

Return to query results.
Submit another query.