DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12016 and F19B6.1

DIOPT Version :9

Sequence 1:NP_647805.1 Gene:CG12016 / 38411 FlyBaseID:FBgn0035436 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001368094.1 Gene:F19B6.1 / 178181 WormBaseID:WBGene00008948 Length:569 Species:Caenorhabditis elegans


Alignment Length:304 Identity:57/304 - (18%)
Similarity:100/304 - (32%) Gaps:114/304 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PQW-----------LVIGISGVTCGGKTTLAHSLHDYFKGLRGAPLWNSPYTIGEVRLISQDDYF 55
            |.|           .|||:.|.:..||||:|..:.:..    |.| |        |.::|.|.::
 Worm   105 PPWYDKKGKSLKHPFVIGVCGGSASGKTTVAEKIVERL----GIP-W--------VTILSMDSFY 156

  Fly    56 ---LPVEDK-RHQRN---EALNAINFELITSLDMAKMLNDIAHIIKGRHVAPEPQEHLVTYANFE 113
               .|.|.| .|:..   :..||.:|:|:  .::.|.|.:      |:.|.       |...:|.
 Worm   157 KVLTPEEIKAAHESRYNFDGPNAFDFDLL--YEVLKRLRE------GKSVD-------VPVYDFN 206

  Fly   114 HYAQQFQQQYQYNANYYKQANGGVYQYPPQQHPRHHPHHQQHHHQHHQIQQQQQHIMSINAQIAA 178
            .:::....:..|.|                                                   
 Worm   207 THSRDPNSKMMYGA--------------------------------------------------- 220

  Fly   179 QLRDKKVNFLLVEGFMIFNQPELLALCNIKYHFHLPYEKCFERRSKR--TYDPPDVTG----YFE 237
                   :.|:.||.:.|:...:..|.::|.......:....||..|  |....|:.|    ||.
 Worm   221 -------DVLIFEGILAFHDERIKNLMDMKVFVDTDGDLRLARRIVRDVTDRGRDIDGIMEQYFT 278

  Fly   238 LCVWPHYEKNFSEYRDCKDITFLNG---EIAKEKILAFVLHRIV 278
            . |.|.::|..:...|..|:....|   ::|.:.|:..|:.::|
 Worm   279 F-VKPAFDKYIAPCMDSADLIVPRGGENDVAIDMIVQNVMAQLV 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12016NP_647805.1 NRK1 6..255 CDD:238982 49/261 (19%)
F19B6.1NP_001368094.1 UMPK 120..319 CDD:238981 54/285 (19%)
UPRTase 355..557 CDD:405383
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.