DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG12016 and CTNNB1

DIOPT Version :9

Sequence 1:	NP_647805.1	Gene:	CG12016 / 38411	FlyBaseID:	FBgn0035436	Length:	323	Species:	Drosophila melanogaster
Sequence 2:	NP_001091679.1	Gene:	CTNNB1 / 1499	HGNCID:	2514	Length:	781	Species:	Homo sapiens

Alignment Length:	127	Identity:	26/127 - (20%)
Similarity:	43/127 - (33%)	Gaps:	28/127 - (22%)

- Green bases have known domain annotations that are detailed below.

  Fly    94 KGRHVAPEPQEHLVTYANFEHYAQQFQQQY------QYNANYYKQANGGVY--------QYPPQQ 144
            ||.....:.....|.|...:.::|.|.|:.      ||.....::....::        |.|..|
Human    49 KGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQ 113

  Fly   145 HPRHHPHHQQHHHQHHQIQQQQQHIMSINAQIAAQLRDKKVNFLLVEGFMIFNQPELLALCN 206
            ....||.:.|...:..|:.:... :..||.|..|:|..:.:             |||..|.|
Human   114 FDAAHPTNVQRLAEPSQMLKHAV-VNLINYQDDAELATRAI-------------PELTKLLN 161

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG12016	NP_647805.1	NRK1	6..255	CDD:238982	26/127 (20%)
CTNNB1	NP_001091679.1	Interaction with VCL. /evidence=ECO:0000250	2..23
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	34..57		2/7 (29%)
		SRP1	142..>431	CDD:227396	8/33 (24%)
		ARM 1	151..191		5/24 (21%)
		armadillo repeat	153..178	CDD:293788	5/22 (23%)
		Interaction with BCL9. /evidence=ECO:0000269\|PubMed:17052462	156..178		3/6 (50%)
		armadillo repeat	188..221	CDD:293788
		ARM 2	193..234
		armadillo repeat	230..262	CDD:293788
		ARM	230..262	CDD:214547
		ARM 3	235..276
		armadillo repeat	270..306	CDD:293788
		ARM 4	277..318
		armadillo repeat	312..347	CDD:293788
		ARM 5	319..360
		ARM	350..390	CDD:214547
		armadillo repeat	354..389	CDD:293788
		ARM 6	361..389
		ARM 7	400..441
		armadillo repeat	402..427	CDD:293788
		Arm	431..473	CDD:395413
		armadillo repeat	435..473	CDD:293788
		ARM 8	442..484
		armadillo repeat	482..517	CDD:293788
		ARM 9	489..530
		armadillo repeat	524..582	CDD:293788
		ARM 10	531..571
		Arm	583..622	CDD:395413
		armadillo repeat	587..621	CDD:293788
		ARM 11	594..636
		armadillo repeat	629..662	CDD:293788
		ARM 12	637..666
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	705..781
		Interaction with SCRIB. /evidence=ECO:0000250	772..781
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0572
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900