DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12016 and uck1

DIOPT Version :9

Sequence 1:NP_647805.1 Gene:CG12016 / 38411 FlyBaseID:FBgn0035436 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_002936235.5 Gene:uck1 / 100491950 XenbaseID:XB-GENE-961187 Length:271 Species:Xenopus tropicalis


Alignment Length:298 Identity:51/298 - (17%)
Similarity:90/298 - (30%) Gaps:122/298 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VIGISGVTCGGKTTLAHSLHDYFKGLRGAPLWNSPYTIGE---------VRLISQDDYFLPVEDK 61
            :||:||.|..||:|:...:.:               .:|:         |.::|||.::..:..:
 Frog    19 LIGVSGGTASGKSTVCEKIME---------------LLGQNEVDHRQRKVVILSQDRFYKVLTPE 68

  Fly    62 RHQRNEALNA-INFELITSLDMAKMLNDIAHIIKGRHVAPEPQEHLVTYANFEHYAQQFQQQYQY 125
              |:..||.. .||:...:.|...|...:..|::|: :...|....:|::.......        
 Frog    69 --QKARALKGQYNFDHPDAFDNELMHRTLTRIMEGQ-IVDVPMYDFITHSRLPETTT-------- 122

  Fly   126 NANYYKQANGGVYQYPPQQHPRHHPHHQQHHHQHHQIQQQQQHIMSINAQIAAQLRDKKVNFLLV 190
                         .||                                           .:.:|.
 Frog   123 -------------VYP-------------------------------------------ADVVLF 131

  Fly   191 EGFMIFNQPELLALCNIKYHFHLPYEKCFERR----SKRTYDPPDVTGYFELCVWPHYEKNFS-- 249
            ||.:.|...|:..:..:|.......:....||    .||..|...:...:...|.|.:|: ||  
 Frog   132 EGILAFYNQEIRDMFQLKLFVDTDSDVRLSRRVLRDMKRGRDLEQILSQYTTFVKPAFEE-FSLP 195

  Fly   250 --EYRD-------------------CKDITFLNGEIAK 266
              :|.|                   .:||  |||:|.|
 Frog   196 TKKYADVIIPRGVDNMVAINLIVQHIQDI--LNGDICK 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12016NP_647805.1 NRK1 6..255 CDD:238982 44/285 (15%)
uck1XP_002936235.5 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.