DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12016 and nmrk1

DIOPT Version :9

Sequence 1:NP_647805.1 Gene:CG12016 / 38411 FlyBaseID:FBgn0035436 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_012822820.1 Gene:nmrk1 / 100125192 XenbaseID:XB-GENE-993956 Length:221 Species:Xenopus tropicalis


Alignment Length:301 Identity:75/301 - (24%)
Similarity:115/301 - (38%) Gaps:99/301 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPQWLVIGISGVTCGGKTTLAHSLHDYFKGLRGAPLWNSPYTIGEVRLISQDDYFLPVEDKRHQR 65
            |.:..:|||||:|.|||||||:.|      |:..|         ...||.|||||.|..|.....
 Frog     1 MMKQFIIGISGITNGGKTTLANRL------LKLLP---------NCSLICQDDYFKPDSDIETDE 50

  Fly    66 NEALNAINFELITSLDMAKMLNDIAHIIKGRHVAPEPQEHLVTYANFEHYAQQFQQQYQYNANYY 130
            |   ....::.|.:|||..|:..:                                         
 Frog    51 N---GFKQYDTIEALDMETMIKAV----------------------------------------- 71

  Fly   131 KQANGGVYQYPPQQHPRHHPHHQQHHHQHHQIQQQQQHIMSINAQIAAQLRDKKVNFLLVEGFMI 195
                                        |..|:..|..:.....:......::|..||:||||::
 Frog    72 ----------------------------HSWIKLSQDVLAMEEKKEMCSTCEEKAYFLIVEGFLL 108

  Fly   196 FNQPE-----LLALCNIKYHFHLPYEKCFERRSKRTYDPPDVTGYFELCVWPHYEKNFSEYRDC- 254
            ::...     |..:.|.||...:|||:..:|||:|.|:|||..|||:..|||.:.|:..|..:. 
 Frog   109 YHYKNYYCRPLENVLNRKYFLSIPYEESKQRRSRRIYNPPDPPGYFDGHVWPMFLKHKKEMEETH 173

  Fly   255 KDITFLNGEIAKEKILAFVLHRIV------HYFKERCEVPA 289
            .||.:|:|..::::|.:.|...|:      ...|.:|..|:
 Frog   174 SDIVYLDGTKSEDEIQSLVYSDIITSQFTSKAAKRKCWSPS 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12016NP_647805.1 NRK1 6..255 CDD:238982 64/254 (25%)
nmrk1XP_012822820.1 NRK1 6..171 CDD:238982 64/251 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H6787
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.