DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KPNA5 and Kap-alpha3

DIOPT Version :9

Sequence 1:NP_001353233.1 Gene:KPNA5 / 3841 HGNCID:6398 Length:559 Species:Homo sapiens
Sequence 2:NP_001163572.1 Gene:Kap-alpha3 / 41158 FlyBaseID:FBgn0027338 Length:514 Species:Drosophila melanogaster


Alignment Length:525 Identity:239/525 - (45%)
Similarity:328/525 - (62%) Gaps:20/525 - (3%)


- Green bases have known domain annotations that are detailed below.


Human    33 RMKSYKNKALNPQEMRRRREEEGIQLRKQKREEQLFKRRNVYLPRNDESMLESPIQDPDISSTVP 97
            |::::|||..:..||||||.|..::|||.||||.:.|||||  |..|.:..|    :..:||::.
  Fly     8 RLQNFKNKGKDQDEMRRRRNEVTVELRKNKREETILKRRNV--PNLDSNTDE----EEQLSSSID 66

Human    98 IPEEEVVTTDMVQMIFSNNADQQLTATQKFRKLLSKEPNPPIDQVIQKPGVVQRFVKFLERNENC 162
            :.:......|      :...:|||.|.|..|||||.:.||||:.:||. .::...|:.|:::.:.
  Fly    67 LKKLAKAAAD------ATKPEQQLAAVQAARKLLSSDKNPPINDLIQS-DILPILVECLKQHNHT 124

Human   163 TLQFEAAWALTNIASGTFLHTKVVIETGAVPIFIKLLNSEHEDVQEQAVWALGNIAGDNAECRDF 227
            .||||||||||||||||...|..|:..||||:|::||||...:|.||||||||||.||....|||
  Fly   125 MLQFEAAWALTNIASGTSAQTNEVVAAGAVPLFLQLLNSPAPNVCEQAVWALGNIIGDGPLLRDF 189

Human   228 VLNCEILPPLLELLTNSNRLTTTRNAVWALSNLCRGKNPPPNFSKVSPCLNVLSRLLFSSDPDVL 292
            |:...::.|||..:.....:|..||..|.:.||||.|:|.|..:.:...|..|:.|:..:|.::|
  Fly   190 VIKHGVVQPLLSFIKPDIPITFLRNVTWVIVNLCRNKDPAPPTATIHEILPALNVLIHHTDTNIL 254

Human   293 ADVCWALSYLSDGPNDKIQAVIDSGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILN 357
            .|..||:|||:||.||:||.||:|||..:|:.||.:::.||.:.|||||||||||.|.||||:||
  Fly   255 VDTVWAISYLTDGGNDQIQMVIESGVVPKLIPLLGNSEVKVQTAALRAVGNIVTGSDEQTQVVLN 319

Human   358 CSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAA 422
            ..||.....|||.|||.|||||.|.:|||||||::|:||||:..:.|.:||.|.|.||:|:||||
  Fly   320 YDALSYFPGLLSHPKEKIRKEAVWFLSNITAGNQSQVQAVINVGLLPKIIENLSKGEFQTQKEAA 384

Human   423 WAITNATSGGTPEQIRYLVALGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGIGIN 487
            |||:|.|..|..||:..|:..|.|.|.||||:..|::::.|.|:||.|:|::.:..       :.
  Fly   385 WAISNLTISGNREQVFTLIKEGVIPPFCDLLSCQDTQVINVVLDGLNNMLKVADSH-------VE 442

Human   488 PYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGVEEDDPSIVPQVDENQQQFIFQQQEA 552
            .....|||..||.|||.||||||.|||:.|:::|:.||..|.:..::.|..|..|..|.......
  Fly   443 AVANCIEECEGLAKIERLQSHENVEIYKLAYEIIDQYFTDEGEQTNMAPTSDGAQYNFDPHADRL 507

Human   553 PMDGF 557
            .|:.|
  Fly   508 TMNSF 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KPNA5NP_001353233.1 Arm_3 56..541 CDD:330530 224/484 (46%)
armadillo repeat 142..175 CDD:293788 14/32 (44%)
armadillo repeat 183..219 CDD:293788 22/35 (63%)
armadillo repeat 225..260 CDD:293788 11/34 (32%)
armadillo repeat 277..302 CDD:293788 9/24 (38%)
armadillo repeat 310..346 CDD:293788 20/35 (57%)
armadillo repeat 354..386 CDD:293788 18/31 (58%)
armadillo repeat 394..430 CDD:293788 20/35 (57%)
armadillo repeat 437..471 CDD:293788 13/33 (39%)
Kap-alpha3NP_001163572.1 IBB 7..88 CDD:280005 33/91 (36%)
SRP1 8..500 CDD:227396 236/511 (46%)
ARM 104..224 CDD:237987 57/120 (48%)
armadillo repeat 104..137 CDD:293788 14/33 (42%)
armadillo repeat 145..181 CDD:293788 22/35 (63%)
armadillo repeat 187..222 CDD:293788 11/34 (32%)
ARM 236..350 CDD:237987 62/113 (55%)
armadillo repeat 239..264 CDD:293788 9/24 (38%)
armadillo repeat 272..308 CDD:293788 20/35 (57%)
armadillo repeat 314..348 CDD:293788 20/33 (61%)
ARM 315..433 CDD:237987 63/117 (54%)
armadillo repeat 356..390 CDD:293788 19/33 (58%)
armadillo repeat 399..433 CDD:293788 13/33 (39%)
Arm_3 442..485 CDD:292804 22/42 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5064
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54553
OrthoDB 1 1.010 - - D1111872at2759
OrthoFinder 1 1.000 - - FOG0000157
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2158
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.