DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drsl5 and Drsl4

DIOPT Version :9

Sequence 1:NP_647803.1 Gene:Drsl5 / 38409 FlyBaseID:FBgn0035434 Length:69 Species:Drosophila melanogaster
Sequence 2:NP_728862.1 Gene:Drsl4 / 317954 FlyBaseID:FBgn0052282 Length:71 Species:Drosophila melanogaster


Alignment Length:69 Identity:44/69 - (63%)
Similarity:51/69 - (73%) Gaps:1/69 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 QIKFLYLFLAVMTIFILGAKEADA-DCLSGRYGGPCAVWDNETCRRVCKEEGRSSGHCSPSLKCW 65
            |||.|:..|||:||.::.|..|.| ||.|||:.|||..||.|.|||:|:||||.|||||.|||||
  Fly     3 QIKGLFALLAVVTIVLMVANSASAVDCPSGRFSGPCWAWDGEQCRRLCREEGRVSGHCSASLKCW 67

  Fly    66 CEGC 69
            ||.|
  Fly    68 CEQC 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drsl5NP_647803.1 Gamma-thionin 26..68 CDD:395240 30/41 (73%)
Drsl4NP_728862.1 Gamma-thionin 28..70 CDD:395240 30/41 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448671
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008543
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.