DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZnT63C and SLC30A3

DIOPT Version :9

Sequence 1:NP_001261364.1 Gene:ZnT63C / 38407 FlyBaseID:FBgn0035432 Length:545 Species:Drosophila melanogaster
Sequence 2:XP_005264604.1 Gene:SLC30A3 / 7781 HGNCID:11014 Length:412 Species:Homo sapiens


Alignment Length:59 Identity:20/59 - (33%)
Similarity:40/59 - (67%) Gaps:3/59 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FFFV--EIIVGYVTNSMALVADSFHMLGDIAALVISFLSVKMSPKKWSKN-TFGWARAE 76
            |.|:  |::.||:.:|:|::.|:.|:|.|:.:::.|..|:.:|.:..::. ||||.|:|
Human    84 FVFMAGEVVGGYLAHSLAIMTDAAHLLADVGSMMGSLFSLWLSTRPATRTMTFGWHRSE 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZnT63CNP_001261364.1 CzcD 10..339 CDD:224151 20/59 (34%)
Cation_efflux 21..260 CDD:279834 20/59 (34%)
SLC30A3XP_005264604.1 Cation_efflux 85..>142 CDD:279834 18/56 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152428
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1230
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.