powered by:
Protein Alignment ZnT63C and SLC30A3
DIOPT Version :9
Sequence 1: | NP_001261364.1 |
Gene: | ZnT63C / 38407 |
FlyBaseID: | FBgn0035432 |
Length: | 545 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_005264604.1 |
Gene: | SLC30A3 / 7781 |
HGNCID: | 11014 |
Length: | 412 |
Species: | Homo sapiens |
Alignment Length: | 59 |
Identity: | 20/59 - (33%) |
Similarity: | 40/59 - (67%) |
Gaps: | 3/59 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 21 FFFV--EIIVGYVTNSMALVADSFHMLGDIAALVISFLSVKMSPKKWSKN-TFGWARAE 76
|.|: |::.||:.:|:|::.|:.|:|.|:.:::.|..|:.:|.:..::. ||||.|:|
Human 84 FVFMAGEVVGGYLAHSLAIMTDAAHLLADVGSMMGSLFSLWLSTRPATRTMTFGWHRSE 142
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C165152428 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1230 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.740 |
|
Return to query results.
Submit another query.