DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14968 and NOS1AP

DIOPT Version :10

Sequence 1:NP_647800.1 Gene:CG14968 / 38406 FlyBaseID:FBgn0035431 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_055512.1 Gene:NOS1AP / 9722 HGNCID:16859 Length:506 Species:Homo sapiens


Alignment Length:192 Identity:46/192 - (23%)
Similarity:80/192 - (41%) Gaps:54/192 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DLDSQVNVEDL---PITFKVKYIGS----------EVARGLWGIKYTRRPVDIMVGVAKNLPPNK 61
            ||...::.||.   .|.|:.||:||          |:...:..|:|..:        |||:...|
Human    15 DLRIPLHNEDAFQHGICFEAKYVGSLDVPRPNSRVEIVAAMRRIRYEFK--------AKNIKKKK 71

  Fly    62 VLPNCELKVSTDGVQLEIISPKASI-----NHWS-------------YPIDTISYGVQDLVYTRV 108
            |    .:.||.|||:: |:..|..:     ..|:             |.|..:|:..|||   ::
Human    72 V----SIMVSVDGVKV-ILKKKKKLLLLQKKEWTWDESKMLVMQDPIYRIFYVSHDSQDL---KI 128

  Fly   109 FAMIVVKDESSPHPFEVHAFVCDSRAMARKLTFALAAAFQ-----DYSRRVKEATGEEEGEA 165
            |:.| .:|.:| :.|..:.|....::.|.::...:..||:     ......:.|.|:|:||:
Human   129 FSYI-ARDGAS-NIFRCNVFKSKKKSQAMRIVRTVGQAFEVCHKLSLQHTQQNADGQEDGES 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14968NP_647800.1 PTB_LDLRAP_insect-like 23..147 CDD:269982 34/151 (23%)
NOS1APNP_055512.1 PTB_CAPON-like 2..185 CDD:269968 43/187 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..224 5/14 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 241..260
PDZ-binding domain 494..506
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.